From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003722000
  • symbol?: sbcC
  • description?: nuclease SbcCD subunit C

      descriptions from strain specific annotations:

    • nuclease SbcCD subunit C
    • exonuclease SbcC
    • DNA repair ATPase-like protein
    • exodeoxyribonuclease SbcC
    • exonuclease subunit SbcC
    • putative exonuclease
  • strand?: +
  • coordinates?: 4022595..4025439
  • synteny block?: BlockID0027880
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1382 (sbcC)
    N315:
    NCTC8325:
    Newman:
    NWMN_1258 (sbcC)
    USA300_FPR3757:
    04-02981:
    SA2981_1301 (sbcC)
    08BA02176:
    C248_1382
    11819-97:
    MS7_1305 (sbcC)
    71193:
    ST398NM01_1348
    ECT-R 2:
    ECTR2_1205
    ED133:
    SAOV_1359
    ED98:
    SAAV_1327 (sbcC)
    HO 5096 0412:
    SAEMRSA15_11930
    JH1:
    SaurJH1_1435
    JH9:
    SaurJH9_1408
    JKD6008:
    SAA6008_01312 (sbcC)
    JKD6159:
    SAA6159_01213 (sbcC)
    LGA251:
    SARLGA251_12550
    M013:
    M013TW_1294
    MRSA252:
    SAR1357
    MSHR1132:
    SAMSHR1132_11910
    MSSA476:
    SAS1286
    Mu3:
    SAHV_1335
    Mu50:
    SAV1346
    MW2:
    MW1233
    RF122:
    SAB1204
    ST398:
    SAPIG1348
    T0131:
    SAT0131_01417 (nirR)
    TCH60:
    HMPREF0772_11862 (sbcC)
    TW20:
    SATW20_13480
    USA300_TCH1516:
    USA300HOU_1281 (sbcC)
    VC40:
    SAVC_05970

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKPLHLKLNNFGPFLKEEIDFSKIDNNELFLISGKTGSGKTMIFDAMTYALFGKASTEQR
    N315            MKPLHLKLNNFGPFLKEEIDFSKIDNNELFLISGKTGSGKTMIFDAMTYALFGKASTEQR
    NCTC8325        MKPLHLKLNNFGPFLKEEIDFSKIDNNELFLISGKTGSGKTMIFDAMTYALFGKASTEQR
    Newman          MKPLHLKLNNFGPFLKEEIDFSKIDNNELFLISGKTGSGKTMIFDAMTYALFGKASTEQR
    USA300_FPR3757  MKPLHLKLNNFGPFLKEEIDFSKIDNNELFLISGKTGSGKTMIFDAMTYALFGKASTEQR
                    ************************************************************

    COL             EENDLRSHFADGKQPMSVTFEFQLNHRIYKVHRQGPYIKEGNTTKTNAKFDVFEMVDGKY
    N315            EENDLRSHFADGKQPMSVTFEFQLNHRIYKVHRQGPYIKEGNTTKTNAKFDVFEMVDGKY
    NCTC8325        EENDLRSHFADGKQPMSVTFEFQLNHRIYKVHRQGPYIKEGNTTKTNAKFDVFEMVDGKY
    Newman          EENDLRSHFADGKQPMSVTFEFQLNHRIYKVHRQGPYIKEGNTTKTNAKFDVFEMVDGKY
    USA300_FPR3757  EENDLRSHFADGKQPMSVTFEFQLNHRIYKVHRQGPYIKEGNTTKTNAKFDVFEMVDGKY
                    ************************************************************

    COL             EIRESKVISGTQFIIELLGVNADQFRQLFILPQGEFKRFLISNSREKQGILRTLFDSEKF
    N315            EIRESKVISGTQFIIELLGVNADQFRQLFILPQGEFKRFLISNSREKQGILRTLFDSEKF
    NCTC8325        EIRESKVISGTQFIIELLGVNADQFRQLFILPQGEFKRFLISNSREKQGILRTLFDSEKF
    Newman          EIRESKVISGTQFIIELLGVNADQFRQLFILPQGEFKRFLISNSREKQGILRTLFDSEKF
    USA300_FPR3757  EIRESKVISGTQFIIELLGVNADQFRQLFILPQGEFKRFLISNSREKQGILRTLFDSEKF
                    ************************************************************

    COL             EAIREILKEEVKKEKAQIENRYQQIDLLWQEIESFDDDNIKGLLEVATQQIDKLIENIPL
    N315            EAIREILKEELKKEKAQIENRYQQIDLLWQEIESFDDDKIKGLLELATQQIDKLIENIPL
    NCTC8325        EAIREILKEEVKKEKAQIENRYQQIDLLWQEIESFDDDNIKGLLEVATQQIDKLIENIPL
    Newman          EAIREILKEEVKKEKAQIENRYQQIDLLWQEIESFDDDNIKGLLEVATQQIDKLIENIPL
    USA300_FPR3757  EAIREILKEEVKKEKAQIENRYQQIDLLWQEIESFDDDNIKGLLEVATQQIDKLIENIPL
                    **********:***************************:******:**************

    COL             LQARSKEILASVNESKETAIKEFEIIEKKTLENNILKDNINQLNKNKIDFVQLKEQQPEI
    N315            LQARSKEILAFVNESKETAIKEYEIIEKKTLENNILKDNINQLNKNKIDFVQLKEQQPEI
    NCTC8325        LQARSKEILASVNESKETAIKEFEIIEKKTLENNILKDNINQLNKNKIDFVQLNEQQPEI
    Newman          LQARSKEILASVNESKETAIKEFEIIEKKTLENNILKDNINQLNKNKIDFVQLKEQQPEI
    USA300_FPR3757  LQARSKEILASVNESKETAIKEFEIIEKKTLENNILKDNINQLNKNKIDFVQLKEQQPEI
                    ********** ***********:******************************:******

    COL             EGIEAKLKLLQDITNLLNYIENREKIETKIANSKKDISKTNNKILNLDCDKRNIDKEKKM
    N315            DEIEAKLKLLQDITNLLNYIENREKIETKIANSKKDISKTNNKILNLDCDKRNIDKEKKM
    NCTC8325        EGIEAKLKLLQDITNLLNYIENREKIETKIANSKKDISKTNNKILNLDCDKRNIDKEKKM
    Newman          EGIEAKLKLLQDITNLLNYIENREKIETKIANSKKDISKTNNKILNLDCDKRNIDKEKKM
    USA300_FPR3757  EGIEAKLKLLQDITNLLNYIENREKIETKIANSKKDISKTNNKILNLDCDKRNIDKEKKM
                    : **********************************************************

    COL             LEENGDLIESKISFIDKTRVLFNDINKYQQSYLNIERLRTEGEQLGDELNDLIKGLETVE
    N315            LEENGDLIESKTSFIDKTRVLFNDINKYQQSYLNIECLITEGEQLGDELNNLIKGLEKVE
    NCTC8325        LEENGDLIESKISFIDKTRVLFNDINKYQQSYLNIERLRTEGEQLGDELNDLIKGLETVE
    Newman          LEENGDLIESKISFIDKTRVLFNDINKYQQSYLNIERLRTEGEQLGDELNDLIKGLETVE
    USA300_FPR3757  LEENGDLIESKISFIDKTRVLFNDINKYQQSYLNIERLRTEGEQLGDELNDLIKGLETVE
                    *********** ************************ * ***********:******.**

    COL             DSIGNNQSDYEKIIELNNTITNINNEINIIKENEKAKAELDKLLGSKQELENQINEETSI
    N315            DSIGNNESDYEKIIELNNAITNINNEINIIKENEKAKAELDKLLGSKQELENQINEETTI
    NCTC8325        DSIGNNQSDYEKIIELNNTITNINNEINIIKENEKAKAELDKLLGSKQELENQINEETSI
    Newman          DSIGNNQSDYEKIIELNNTITNINNEINIIKENEKAKAELDKLLGSKQELENQINEETSI
    USA300_FPR3757  DSIGNNQSDYEKIIELNNTITNINNEINIIKENEKAKAELDKLLGSKQELENQINEETSI
                    ******:***********:***************************************:*

    COL             LKNLEIKLDRYDKTKLDLNDKESFISEIKSAVNIGDQCPICGNEIQDLGHHIDFDSIAKR
    N315            MKNLEIKLDHYDKSKLDLNDKESFISEIKSAVKIGDQCPICGNEIQDLGHHIDFDSIAKR
    NCTC8325        LKNLEIKLDRYDKTKLDLNDKESFISEIKSAVNIGDQCPICGNEIQDLGHHIDFDSIAKR
    Newman          LKNLEIKLDRYDKTKLDLNDKESFISEIKSAVNIGDQCPICGNEIQDLGHHIDFDSIAKR
    USA300_FPR3757  LKNLEIKLDRYDKTKLDLNDKESFISEIKSAVNIGDQCPICGNEIQDLGHHIDFDSIAKR
                    :********:***:******************:***************************

    COL             QNEIKEIEANIHAIKSNIAVHNSEIKFVNEKISNINIKTQSDFSLEVLNKRLLENENALN
    N315            QNEIKEIEANIHAIKSNIAVHNSEIKFVNEKISNINIKTQSDFSLEVLNKRLLENENALN
    NCTC8325        QNEIKEIEANIHAIKSNIAVHNSEIKFVNEKISNINIKTQSDFSLEVLNKRLLENENALN
    Newman          QNEIKEIEANIHAIKSNIAVHNSEIKFVNEKISNINIKTQSDFSLEVLNKRLLENENALN
    USA300_FPR3757  QNEIKEIEANIHAIKSNIAVHNSEIKFVNEKISNINIKTQSDFSLEVLNKRLLENENALN
                    ************************************************************

    COL             NQRDLNKFIEQMKEEKDNLTLQIHNKQLRLNKNESELKLCRDLITEFETLSKYNNITNFE
    N315            NQRDLNKFIEQMKEEKDNLTLQIHNKQLRLNKNESELKLCRDLITEFETLSKYNNITNFE
    NCTC8325        NQRDLNKFIEQMKEEKDNLTLQIHNKQLRLNKNESELKLCRDLITEFETLSKYNNITNFE
    Newman          NQRDLNKFIEQMKEEKDNLTLQIHNKQLRLNKNESELKLCRDLITEFETLSKYNNITNFE
    USA300_FPR3757  NQRDLNKFIEQMKEEKDNLTLQIHNKQLRLNKNESELKLCRDLITEFETLSKYNNITNFE
                    ************************************************************

    COL             VDYKKYVQDVNQHQELSKEIEDKLMQLSQRKLIEQNNLNHYENQLETYNNDLELNEQSIE
    N315            VDYKKYVQDVNQHQELSKEIEDKLMQLSQRKLIEQNNLNHYENQLETYNNDLELNEQSIE
    NCTC8325        VDYKKYVQDVNQHQELSKEIEDKLMQLSQRKLIEQNNLNHYENQLETYNNDLELNEQSIE
    Newman          VDYKKYVQDVNQHQELSKEIEDKLMQLSQRKLIEQNNLNHYENQLETYNNDLELNEQSIE
    USA300_FPR3757  VDYKKYVQDVNQHQELSKEIEDKLMQLSQRKLIEQNNLNHYENQLETYNNDLELNEQSIE
                    ************************************************************

    COL             MEMSRLNLTDDNDIDEIIAWRGEQEELEQKRDTYKKRYHEFEMEIARLESLTKDKELLDS
    N315            MEMSRLNLTDDNDINEIIAWRGEQEELEQKRDTYKKRYHEFEMEIARLESLTKDKELLDS
    NCTC8325        MEMSRLNLTDDNDIDEIIAWRGEQEELEQKRDTYKKRYHEFEMEIARLESLTKDKELLDS
    Newman          MEMSRLNLTDDNDIDEIIAWRGEQEELEQKRDTYKKRYHEFEMEIARLESLTKDKELLDS
    USA300_FPR3757  MEMSRLNLTDDNDIDEIIAWRGEQEELEQKRDTYKKRYHEIEMEIARLESLTKDKELLDS
                    **************:*************************:*******************

    COL             DKLKDEYELKKGKMNTLIDEYSAVHYQCQNNINKTQSIVSHINYLNQELKDQQEIFQLAE
    N315            DKLKDEYEQKKEKMNTLIDEYSAVHYQCQNNINKTQSIVSHINYLNQELKDQQEIFQLAE
    NCTC8325        DKLKDEYELKKGKMNTLIDEYSAVHYQCQNNINKTQSIVSHINYLNQELKDQQEIFQLAE
    Newman          DKLKDEYELKKGKMNTLIDEYSAVHYQCQNNINKTQSIVSHINYLNQELKDQQEIFQLAE
    USA300_FPR3757  DKLKDEYELKKGKMNTLIDEYSAVHYQCQNNINKTQSIVSHINYLNQELKDQQEIFQLAE
                    ******** ** ************************************************

    COL             IVSGKNNKNLTLENFVLIYYLDQIIAQANLRLATMSDNRYQLIRREAVSHGLSGLEIDVF
    N315            IVSGKNNKNLTLENFVLIYYLDQIIAQANLRLATMSDNRYQLIRREAVSHGLSGLEIDVF
    NCTC8325        IVSGKNNKNLTLENFVLIYYLDQIIAQANLRLATMSDNRYQLIRREAVSHGLSGLEIDVF
    Newman          IVSGKNNKNLTLENFVLIYYLDQIIAQANLRLATMSDNRYQLIRREAVSHGLSGLEIDVF
    USA300_FPR3757  IVSGKNNKNLTLENFVLIYYLDQIIAQANLRLATMSDNRYQLIRREAVSHGLSGLEIDVF
                    ************************************************************

    COL             DLHSNKSRHISSLSGGETFQSSLALALGLSEIVQQQSGGISLESIFIDEGFGTLDQETLE
    N315            DLHSNKSRHISSLSGGETFQSSLALALGLSEIVQQQSGGISLESIFIDEGFGTLDQETLE
    NCTC8325        DLHSNKSRHISSLSGGETFQSSLALALGLSEIVQQQSGGISLESIFIDEGFGTLDQETLE
    Newman          DLHSNKSRHISSLSGGETFQSSLALALGLSEIVQQQSGGISLESIFIDEGFGTLDQETLE
    USA300_FPR3757  DLHSNKSRHISSLSGGETFQSSLALALGLSEIVQQQSGGISLESIFIDEGFGTLDQETLE
                    ************************************************************

    COL             TALDTLLNLKSTGRMVGIISHVSELKNRIPLVLEVKSDQYQSSTRFKRN
    N315            TALDTLLNLKSTGRMVGIISHVSELKNRIPLVLEVKSDQYQSSTRFKRN
    NCTC8325        TALDTLLNLKSTGRMVGIISHVSELKNRIPLVLEVKSDQYQSSTRFKRN
    Newman          TALDTLLNLKSTGRMVGIISHVSELKNRIPLVLEVKSDQYQSSTRFKRN
    USA300_FPR3757  TALDTLLNLKSTGRMVGIISHVSELKNRIPLVLEVKSDQYQSSTRFKRN
                    *************************************************