From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003728000
  • symbol?: opuD1
  • description?: glycine betaine transporter

      descriptions from strain specific annotations:

    • glycine betaine transporter
    • choline/carnitine/betaine transporter
    • Glycine betaine transporter OpuD
    • BCCT family osmoprotectant transporter
    • glycine betaine transporter 1
    • BCCT family betaine/carnitine/choline transporter
    • transporter, betaine/carnitine/choline transporter family protein
  • strand?: +
  • coordinates?: 4027927..4029573
  • synteny block?: BlockID0027930
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1384 (opuD1)
    N315:
    SA1183 (opuD)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1303 (opuD)
    08BA02176:
    C248_1384 (opuD1)
    11819-97:
    MS7_1307
    71193:
    ST398NM01_1350
    ECT-R 2:
    ECTR2_1207
    ED133:
    SAOV_1361
    ED98:
    SAAV_1329 (opuD1)
    HO 5096 0412:
    SAEMRSA15_11950 (opuD1)
    JH1:
    SaurJH1_1437
    JH9:
    SaurJH9_1410
    JKD6008:
    SAA6008_01314 (opuD)
    JKD6159:
    SAA6159_01215 (opuD)
    LGA251:
    SARLGA251_12570 (opuD1)
    M013:
    M013TW_1296
    MRSA252:
    SAR1361 (opuD1)
    MSHR1132:
    SAMSHR1132_11930
    MSSA476:
    SAS1288
    Mu3:
    SAHV_1337 (opuD)
    Mu50:
    SAV1348 (opuD)
    MW2:
    MW1236 (opuD)
    RF122:
    SAB1206 (opuD)
    ST398:
    SAPIG1350
    T0131:
    SAT0131_01420
    TCH60:
    HMPREF0772_11860 (opuD2)
    TW20:
    SATW20_13500 (opuD1)
    USA300_TCH1516:
    VC40:
    SAVC_05980

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNSSSPENPNGKKYSPVFIYSAIVVAIVVLLGAFLPEQFNYVTNNIKMWITEKLGWYYLI
    N315            MNSSSPENPNGKKYSPVFIYSAIVVAIVVLLGAFLPEQFNYVTNNIKMWITEKLGWYYLI
    NCTC8325        MNSSSPENPNGKKYSPVFIYSAIVVAIVVLLGAFLPEQFNYVTNNIKMWITEKLGWYYLI
    Newman          MNSSSPENPNGKKYSPVFIYSAIVVAIVVLLGAFLPEQFNYVTNNIKMWITEKLGWYYLI
    USA300_FPR3757  MNSSSPENPNGKKYSPVFIYSAIVVAIVVLLGAFLPEQFNYVTNNIKMWITEKLGWYYLI
                    ************************************************************

    COL             LTTIIVFFCIFLIFSPIGKLKLGKPNDKPEFNTISWFAMLFSAGMGIGLVFYGAAEPMAH
    N315            LTTIIVFFCIFLIFSPIGKLKLGKPNDKPEFNTISWFAMLFSAGMGIGLVFYGAAEPMAH
    NCTC8325        LTTIIVFFCIFLIFSPIGKLKLGKPNDKPEFNTISWFAMLFSAGMGIGLVFYGAAEPMAH
    Newman          LTTIIVFFCIFLIFSPIGKLKLGKPNDKPEFNTISWFAMLFSAGMGIGLVFYGAAEPMAH
    USA300_FPR3757  LTTIIVFFCIFLIFSPIGKLKLGKPNDKPEFNTISWFAMLFSAGMGIGLVFYGAAEPMAH
                    ************************************************************

    COL             FATPPTADPKTTEAYTEALRSTFFHWGFHAWAVYGVVALALAYSQFRKGEPGLLSRTLRP
    N315            FATPPTADPKTTEAYTEALRSTFFHWGFHAWAVYGVVALALAYSQFRKGEPGLLSRTLRP
    NCTC8325        FATPPTADPKTTEAYTEALRSTFFHWGFHAWAVYGVVALALAYSQFRKGEPGLLSRTLRP
    Newman          FATPPTADPKTTEAYTEALRSTFFHWGFHAWAVYGVVALALAYSQFRKGEPGLLSRTLRP
    USA300_FPR3757  FATPPTADPKTTEAYTEALRSTFFHWGFHAWAVYGVVALALAYSQFRKGEPGLLSRTLRP
                    ************************************************************

    COL             LLGDKVEGPIGIFIDVLSVFATIVGVAVSLGMGALQINGGLHYLFNVPNNTFVQAIIIIV
    N315            LLGDKVEGPIGIFIDVLSVFATIVGVAVSLGMGALQINGGLHYLFNVPNNTFVQAIIIIV
    NCTC8325        LLGDKVEGPIGIFIDVLSVFATIVGVAVSLGMGALQINGGLHYLFNVPNNTFVQAIIIIV
    Newman          LLGDKVEGPIGIFIDVLSVFATIVGVAVSLGMGALQINGGLHYLFNVPNNTFVQAIIIIV
    USA300_FPR3757  LLGDKVEGPIGIFIDVLSVFATIVGVAVSLGMGALQINGGLHYLFNVPNNTFVQAIIIIV
                    ************************************************************

    COL             VTILFIASAWSGLSKGIQYLSNLNIGLGTILMVAALIVGPTVLILNMLTSSTGSLLNTFL
    N315            VTILFIASAWSGLSKGIQYLSNLNIGLGTILMVAALIVGPTVLILNMLTSSTGSLLNTFL
    NCTC8325        VTILFIASAWSGLSKGIQYLSNLNIGLGTILMVAALIVGPTVLILNMLTSSTGSLLNTFL
    Newman          VTILFIASAWSGLSKGIQYLSNLNIGLGTILMVAALIVGPTVLILNMLTSSTGSLLNTFL
    USA300_FPR3757  VTILFIASAWSGLSKGIQYLSNLNIGLGTILMVAALIVGPTVLILNMLTSSTGSLLNTFL
                    ************************************************************

    COL             FNSFDTAALNPQKREWMSSWTLYYWGWWLSWSPFVGVFIARVSKGRSIREFISGVLLVPA
    N315            FNSFDTAALNPQKREWMSSWTLYYWGWWLSWSPFVGVFIARVSKGRSIREFISGVLLVPA
    NCTC8325        FNSFDTAALNPQKREWMSSWTLYYWGWWLSWSPFVGVFIARVSKGRSIREFISGVLLVPA
    Newman          FNSFDTAALNPQKREWMSSWTLYYWGWWLSWSPFVGVFIARVSKGRSIREFISGVLLVPA
    USA300_FPR3757  FNSFDTAALNPQKREWMSSWTLYYWGWWLSWSPFVGVFIARVSKGRSIREFISGVLLVPA
                    ************************************************************

    COL             IVSFVWFSVFGVLGIETGKKHKEIFDMTPETQLFGVFNHVPFGIVLSLIALLLIASFFIT
    N315            IVSFVWFSVFGVLGIETGKKHKEIFDMTPETQLFGVFNHVPFGIVLSLIALLLIASFFIT
    NCTC8325        IVSFVWFSVFGVLGIETGKKHKEIFDMTPETQLFGVFNHVPFGIVLSLIALLLIASFFIT
    Newman          IVSFVWFSVFGVLGIETGKKHKEIFDMTPETQLFGVFNHVPFGIVLSLIALLLIASFFIT
    USA300_FPR3757  IVSFVWFSVFGVLGIETGKKHKEIFDMTPETQLFGVFNHVPFGIVLSLIALLLIASFFIT
                    ************************************************************

    COL             SADSATFVLGMQTTFGSLNPSSMVKVVWGISQALIAFVLLLAGGGNGAEALNAIQSAAII
    N315            SADSATFVLGMQTTFGSLNPSSMVKVVWGISQALIAFVLLLAGGGNGAEALNAIQSAAII
    NCTC8325        SADSATFVLGMQTTFGSLNPSSMVKVVWGISQALIAFVLLLAGGGNGAEALNAIQSAAII
    Newman          SADSATFVLGMQTTFGSLNPSSMVKVVWGISQALIAFVLLLAGGGNGAEALNAIQSAAII
    USA300_FPR3757  SADSATFVLGMQTTFGSLNPSSMVKVVWGISQALIAFVLLLAGGGNGAEALNAIQSAAII
                    ************************************************************

    COL             SAFPFSFVVILMMVSFYKDANQERKFLGLTLTPNKHRLQEYIKSQQEDYESDILEKRQSR
    N315            SAFPFSFVVILMMVSFYKDANQERKFLGLTLTPNKHRLQEYIKSQQEDYESDILEKRQSR
    NCTC8325        SAFPFSFVVILMMVSFYKDANQERKFLGLTLTPNKHRLQEYIKSQQEDYESDILEKRQSR
    Newman          SAFPFSFVVILMMVSFYKDANQERKFLGLTLTPNKHRLQEYIKSQQEDYESDILEKRQSR
    USA300_FPR3757  SAFPFSFVVILMMVSFYKDANQERKFLGLTLTPNKHRLQEYIKSQQEDYESDILEKRQSR
                    ************************************************************

    COL             RNIEKKDN
    N315            RNIEKKDN
    NCTC8325        RNIEKKDN
    Newman          RNIGKKDN
    USA300_FPR3757  RNIEKKDN
                    *** ****