From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003739000
  • symbol?:
  • description?: iron-sulfur cluster biosynthesis protein

      descriptions from strain specific annotations:

    • iron-sulfur cluster biosynthesis protein
    • iron-sulfur cluster biosynthesis family protein
    • HesB/YadR/YfhF-family protein
  • strand?: -
  • coordinates?: 4036233..4036529
  • synteny block?: BlockID0028020
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1306
    08BA02176:
    C248_1388
    11819-97:
    MS7_1310
    71193:
    ST398NM01_1354
    ECT-R 2:
    ECTR2_1210
    ED133:
    SAOV_1364c
    ED98:
    SAAV_1333
    HO 5096 0412:
    SAEMRSA15_12000
    JH1:
    SaurJH1_1441
    JH9:
    SaurJH9_1414
    JKD6008:
    SAA6008_01317
    JKD6159:
    SAA6159_01218
    LGA251:
    SARLGA251_12620
    M013:
    M013TW_1299
    MRSA252:
    SAR1364
    MSHR1132:
    SAMSHR1132_11960
    MSSA476:
    SAS1292
    Mu3:
    SAHV_1340
    Mu50:
    SAV1352
    MW2:
    MW1239
    RF122:
    SAB1209c
    ST398:
    SAPIG1354
    T0131:
    SAT0131_01423
    TCH60:
    HMPREF0772_11857
    TW20:
    SATW20_13530
    USA300_TCH1516:
    USA300HOU_1285
    VC40:
    SAVC_06005

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQIELTDAAVTWFKNELELPENNKVLVFFVRYGGEFQLKQGFSPAFTVEPKEDVDIGYEQ
    N315            MQIELTDAAVTWFKNELELPENNKVLVFFVRYGGEFQLKQGFSPAFTVEPKEDVDIGYEQ
    NCTC8325        MQIELTDAAVTWFKNELELPENNKVLVFFVRYGGEFQLKQGFSPAFTVEPKEDVDIGYEQ
    Newman          MQIELTDAAVTWFKNELELPENNKVLVFFVRYGGEFQLKQGFSPAFTVEPKEDVDIGYEQ
    USA300_FPR3757  MQIELTDAAVTWFKNELELPENNKVLVFFVRYGGEFQLKQGFSPAFTVEPKEDVDIGYEQ
                    ************************************************************

    COL             QYDDLNVVVAEKDLWYFEDDHIIVNVVDHEDEISYSTK
    N315            QYDDLNVVVAEKDLWYFEDDHIIVNVVDHEDEISYSTK
    NCTC8325        QYDDLNVVVAEKDLWYFEDDHIIVNVVDHEDEISYSTK
    Newman          QYDDLNVVVAEKDLWYFEDDHIIVNVVDHEDEISYSTK
    USA300_FPR3757  QYDDLNVVVAEKDLWYFEDDHIIVNVVDHEDEISYSTK
                    **************************************