From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003740000
  • symbol?: plsY
  • description?: glycerol-3-phosphate acyltransferase

      descriptions from strain specific annotations:

    • glycerol-3-phosphate acyltransferase
    • Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY
    • acyl-phosphate glycerol 3-phosphate acyltransferase
    • membrane protein
    • membrane spanning protein
  • strand?: -
  • coordinates?: 4037020..4037628
  • synteny block?: BlockID0028030
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1307 (plsY)
    08BA02176:
    C248_1389
    11819-97:
    MS7_1311 (plsY)
    71193:
    ST398NM01_1355
    ECT-R 2:
    ECTR2_1211
    ED133:
    SAOV_1365c
    ED98:
    SAAV_1334
    HO 5096 0412:
    SAEMRSA15_12010
    JH1:
    SaurJH1_1442
    JH9:
    SaurJH9_1415
    JKD6008:
    SAA6008_01318
    JKD6159:
    SAA6159_01219
    LGA251:
    SARLGA251_12630
    M013:
    M013TW_1300
    MRSA252:
    SAR1365
    MSHR1132:
    SAMSHR1132_11970
    MSSA476:
    SAS1293
    Mu3:
    SAHV_1341
    Mu50:
    SAV1353
    MW2:
    MW1240
    RF122:
    SAB1210c
    ST398:
    SAPIG1355
    T0131:
    SAT0131_01424
    TCH60:
    HMPREF0772_11856 (plsY)
    TW20:
    SATW20_13540
    USA300_TCH1516:
    USA300HOU_1286
    VC40:
    SAVC_06010

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MMIIVMLLLSYLIGAFPSGFVIGKLFFKKDIRQFGSGNTGATNSFRVLGRPAGFLVTFLD
    N315            MMIIVMLLLSYLIGAFPSGFVIGKLFFKKDIRQFGSGNTGATNSFRVLGRPAGFLVTFLD
    NCTC8325        MMIIVMLLLSYLIGAFPSGFVIGKLFFKKDIRQFGSGNTGATNSFRVLGRPAGFLVTFLD
    Newman          MMIIVMLLLSYLIGAFPSGFVIGKLFFKKDIRQFGSGNTGATNSFRVLGRPAGFLVTFLD
    USA300_FPR3757  MMIIVMLLLSYLIGAFPSGFVIGKLFFKKDIRQFGSGNTGATNSFRVLGRPAGFLVTFLD
                    ************************************************************

    COL             IFKGFITVFFPLWLQVHADGPISTFFTNGLIVGLFAILGHVYPVYLKFQGGKAVATSAGV
    N315            IFKGFITVFFPLWLPVHADGPISTFFTNGLIVGLFAILGHVYPVYLKFQGGKAVATSAGV
    NCTC8325        IFKGFITVFFPLWLQVHADGPISTFFTNGLIVGLFAILGHVYPVYLKFQGGKAVATSAGV
    Newman          IFKGFITVFFPLWLQVHADGPISTFFTNGLIVGLFAILGHVYPVYLKFQGGKAVATSAGV
    USA300_FPR3757  IFKGFITVFFPLWLQVHADGPISTFFTNGLIVGLFAILGHVYPVYLKFQGGKAVATSAGV
                    ************** *********************************************

    COL             VLGVNPILLLILAIIFFIVLKIFKYVSLASIVAAICCVIGSLIIQDYILLVVSFLVSIIL
    N315            VLGVNPILLLILAIIFFIVLKIFKYVSLASIVAAICCVIGSLIIQDYILLVVSFLVSIIL
    NCTC8325        VLGVNPILLLILAIIFFIVLKIFKYVSLASIVAAICCVIGSLIIQDYILLVVSFLVSIIL
    Newman          VLGVNPILLLILAIIFFIVLKIFKYVSLASIVAAICCVIGSLIIQDYILLVVSFLVSIIL
    USA300_FPR3757  VLGVNPILLLILAIIFFIVLKIFKYVSLASIVAAICCVIGSLIIQDYILLVVSFLVSIIL
                    ************************************************************

    COL             IIRHRSNIARIFRGEEPKIKWM
    N315            IIRHRSNIARIFRGEEPKIKWM
    NCTC8325        IIRHRSNIARIFRGEEPKIKWM
    Newman          IIRHRSNIARIFRGEEPKIKWM
    USA300_FPR3757  IIRHRSNIARIFRGEEPKIKWM
                    **********************