From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003741000
  • symbol?: parE
  • description?: DNA topoisomerase IV subunit B

      descriptions from strain specific annotations:

    • DNA topoisomerase IV subunit B
    • Topoisomerase IV subunit B
    • DNA topoisomerase subunit B
    • DNA topoisomerase (ATP-hydrolyzing) ParE
    • DNA topoisomerase IV, B subunit
    • DNA topoisomerase (ATP-hydrolyzing) subunit B, ParE
  • strand?: +
  • coordinates?: 4037741..4039825
  • synteny block?: BlockID0028040
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1389 (parE)
    N315:
    SA1188 (parE)
    NCTC8325:
    Newman:
    NWMN_1267 (parE)
    USA300_FPR3757:
    04-02981:
    SA2981_1308 (parE)
    08BA02176:
    C248_1390 (grlB)
    11819-97:
    MS7_1312 (parE)
    71193:
    ST398NM01_1356
    ECT-R 2:
    ECTR2_1212 (parE)
    ED133:
    SAOV_1366
    ED98:
    SAAV_1335 (parE)
    HO 5096 0412:
    SAEMRSA15_12020 (grlB)
    JH1:
    SaurJH1_1443
    JH9:
    SaurJH9_1416
    JKD6008:
    SAA6008_01319 (gyrB_1)
    JKD6159:
    SAA6159_01220 (parE)
    LGA251:
    SARLGA251_12640 (grlB)
    M013:
    M013TW_1301
    MRSA252:
    SAR1366 (grlB)
    MSHR1132:
    SAMSHR1132_11980
    MSSA476:
    SAS1294
    Mu3:
    SAHV_1342 (parE)
    Mu50:
    SAV1354 (parE)
    MW2:
    MW1241 (parE)
    RF122:
    SAB1211 (grlB)
    ST398:
    SAPIG1356 (parE)
    T0131:
    SAT0131_01425
    TCH60:
    HMPREF0772_11855 (parE)
    TW20:
    SATW20_13550 (grlB)
    USA300_TCH1516:
    USA300HOU_1287 (parE)
    VC40:
    SAVC_06015

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAMNKQNNYSDDSIQVLEGLEAVRKRPGMYIGSTDKRGLHHLVYEIVDNSVDEVLNGYGN
    N315            MAMNKQNNYSDDSIQVLEGLEAVRKRPGMYIGSTDKRGLHHLVYEIVDNSVDEVLNGYGN
    NCTC8325        --MNKQNNYSDDSIQVLEGLEAVRKRPGMYIGSTDKRGLHHLVYEIVDNSVDEVLNGYGN
    Newman          --MNKQNNYSDDSIQVLEGLEAVRKRPGMYIGSTDKRGLHHLVYEIVDNSVDEVLNGYGN
    USA300_FPR3757  MAMNKQNNYSDDSIQVLEGLEAVRKRPGMYIGSTDKRGLHHLVYEIVDNSVDEVLNGYGN
                      **********************************************************

    COL             EIDVTINKDGSISIEDNGRGMPTGIHKSGKPTVEVIFTVLHAGGKFGQGGYKTSGGLHGV
    N315            EIDVTINKDGSISIEDNGRGMPTGIHKSGKPTVEVIFTVLHAGGKFGQGGYKTSGGLHGV
    NCTC8325        EIDVTINKDGSISIEDNGRGMPTGIHKSGKPTVEVIFTVLHAGGKFGQGGYKTSGGLHGV
    Newman          EIDVTINKDGSISIEDNGRGMPTGIHKSGKPTVEVIFTVLHAGGKFGQGGYKTSGGLHGV
    USA300_FPR3757  EIDVTINKDGSISIEDNGRGMPTGIHKSGKPTVEVIFTVLHAGGKFGQGGYKTSGGLHGV
                    ************************************************************

    COL             GASVVNALSEWLEVEIHRDGNIYHQSFKNGGSPSSGLVKKGKTKKTGTKVTFKPDDTIFK
    N315            GASVVNALSEWLEVEIHRDGSIYHQSFKNGGSPSSGLVKKGKTKKTGTKVTFKPDDTIFK
    NCTC8325        GASVVNALSEWLEVEIHRDGNIYHQSFKNGGSPSSGLVKKGKTKKTGTKVTFKPDDTIFK
    Newman          GASVVNALSEWLEVEIHRDGNIYHQSFKNGGSPSSGLVKKGKTKKTGTKVTFKPDDTIFK
    USA300_FPR3757  GASVVNALSEWLEVEIHRDGNIYHQSFKNGGSPSSGLVKKGKTKKTGTKVTFKPDDTIFK
                    ********************.***************************************

    COL             ASTSFNFDVLSERLQESAFLLKNLKITLNDLRSGKERQEHYHYEEGIKEFVSYVNEGKEV
    N315            ASTSFNFDVLSERLQESAFLLKNLKITLNDLRSGKERQEHYHYEEGIKEFVSYVNEGKEV
    NCTC8325        ASTSFNFDVLSERLQESAFLLKNLKITLNDLRSGKERQEHYHYEEGIKEFVSYVNEGKEV
    Newman          ASTSFNFDVLSERLQESAFLLKNLKITLNDLRSGKERQEHYHYEEGIKEFVSYVNEGKEV
    USA300_FPR3757  ASTSFNFDVLSERLQESAFLLKNLKITLNDLRSGKERQEHYHYEEGIKEFVSYVNEGKEV
                    ************************************************************

    COL             LHDVATFSGEANGIEVDVAFQYNDQYSESILSFVNNVRTKDGGTHEVGFKTAMTRVFNDY
    N315            LHDVATFSGEANGIEVDVAFQYNDQYSESILSFVNNVRTKDGGTHEVGFKTAMTRVFNDY
    NCTC8325        LHDVATFSGEANGIEVDVAFQYNDQYSESILSFVNNVRTKDGGTHEVGFKTAMTRVFNDY
    Newman          LHDVATFSGEANGIEVDVAFQYNDQYSESILSFVNNVRTKDGGTHEVGFKTAMTRVFNDY
    USA300_FPR3757  LHDVATFSGEANGIEVDVAFQYNDQYSESILSFVNNVRTKDGGTHEVGFKTAMTRVFNDY
                    ************************************************************

    COL             ARRINELKTKDKNLDGNDIREGLTAVVSVRIPEELLQFEGQTKSKLGTSEARSAVDSVVA
    N315            ARRINELKTKDKNLDGNDIREGLTAVVSVRIPEELLQFEGQTKSKLGTSEARSAVDSVVA
    NCTC8325        ARRINELKTKDKNLDGNDIREGLTAVVSVRIPEELLQFEGQTKSKLGTSEARSAVDSVVA
    Newman          ARRINELKTKDKNLDGNDIREGLTAVVSVRIPEELLQFEGQTKSKLGTSEARSAVDSVVA
    USA300_FPR3757  ARRINELKTKDKNLDGNDIREGLTAVVSVRIPEELLQFEGQTKSKLGTSEARSAVDSVVA
                    ************************************************************

    COL             DKLPFYLEEKGQLSKSLVKKAIKAQQAREAARKAREDARSGKKNKRKDTLLSGKLTPAQS
    N315            DKLPFYLEEKGQLSKSLVKKAIKAQQAREAARKAREDARSGKKNKRKDTLLSGKLTPAQS
    NCTC8325        DKLPFYLEEKGQLSKSLVKKAIKAQQAREAARKAREDARSGKKNKRKDTLLSGKLTPAQS
    Newman          DKLPFYLEEKGQLSKSLVKKAIKAQQAREAARKAREDARSGKKNKRKDTLLSGKLTPAQS
    USA300_FPR3757  DKLPFYLEEKGQLSKSLVKKAIKAQQAREAARKAREDARSGKKNKRKDTLLSGKLTPAQS
                    ************************************************************

    COL             KNTEKNELYLVEGDSAGGSAKLGRDRKFQAILPLRGKVINTEKARLEDIFKNEEINTIIH
    N315            KNTEKNELYLVEGDSAGGSAKLGRDRKFQAILPLRGKVINTEKARLEDIFKNEEINTIIH
    NCTC8325        KNTEKNELYLVEGDSAGGSAKLGRDRKFQAILPLRGKVINTEKARLEDIFKNEEINTIIH
    Newman          KNTEKNELYLVEGDSAGGSAKLGRDRKFQAILPLRGKVINTEKARLEDIFKNEEINTIIH
    USA300_FPR3757  KNTEKNELYLVEGDSAGGSAKLGRDRKFQAILPLRGKVINTEKARLEDIFKNEEINTIIH
                    ************************************************************

    COL             TIGAGVGTDFKIEDSNYNRVIIMTDADTDGAHIQVLLLTFFFKYMKPLVQAGRVFIALPP
    N315            TIGAGVGTDFKIEDSNYNRVIIMTDADTDGAHIQVLLLTFFFKYMKPLVQAGRVFIALPP
    NCTC8325        TIGAGVGTDFKIEDSNYNRVIIMTDADTDGAHIQVLLLTFFFKYMKPLVQAGRVFIALPP
    Newman          TIGAGVGTDFKIEDSNYNRVIIMTDADTDGAHIQVLLLTFFFKYMKPLVQAGRVFIALPP
    USA300_FPR3757  TIGAGVGTDFKIEDSNYNRVIIMTDADTDGAHIQVLLLTFFFKYMKPLVQAGRVFIALPP
                    ************************************************************

    COL             LYKLEKGKGKTKRVEYAWTDEELNKLQKELGKGFTLQRYKGLGEMNPEQLWETTMNPETR
    N315            LYKLEKGKGKTKRVEYAWTDEELNKLQKELGKGFTLQRYKGLGEMNPEQLWETTMNPETR
    NCTC8325        LYKLEKGKGKTKRVEYAWTDEELNKLQKELGKGFTLQRYKGLGEMNPEQLWETTMNPETR
    Newman          LYKLEKGKGKTKRVEYAWTDEELNKLQKELGKGFTLQRYKGLGEMNPEQLWETTMNPETR
    USA300_FPR3757  LYKLEKGKGKTKRVEYAWTDEELNKLQKELGKGFTLQRYKGLGEMNPEQLWETTMNPETR
                    ************************************************************

    COL             TLIRVQVEDEVRSSKRVTTLMGDKVQPRREWIEKHVEFGMQEDQSILDNSEVQVLENDQF
    N315            TLIRVQVEDEVRSSKRVTTLMGDKVQPRREWIEKHVEFGMQEDQSILDNSEVQVLENDQF
    NCTC8325        TLIRVQVEDEVRSSKRVTTLMGDKVQPRREWIEKHVEFGMQEDQSILDNSEVQVLENDQF
    Newman          TLIRVQVEDEVRSSKRVTTLMGDKVQPRREWIEKHVEFGMQEDQSILDNSEVQVLENDQF
    USA300_FPR3757  TLIRVQVEDEVRSSKRVTTLMGDKVQPRREWIEKHVEFGMQEDQSILDNSEVQVLENDQF
                    ************************************************************

    COL             DEEEI
    N315            DEEEI
    NCTC8325        DEEEI
    Newman          DEEEI
    USA300_FPR3757  DEEEI
                    *****