From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003744000
  • symbol?: alsT
  • description?: amino acid carrier protein

      descriptions from strain specific annotations:

    • amino acid carrier protein
    • sodium:alanine symporter family protein
    • amino-acid carrier protein alsT
    • amino acid carrier protein (sodium/alanine symporter)
    • AGCS family alanine or glycine:sodium (Na+) or proton (H+) symporter
    • amino acid carrier family protein
    • AGCS family alanine/glycine:sodium (Na+) symporter
    • Na(+)-linked D-alanine glycine permease
  • strand?: +
  • coordinates?: 4042442..4043938
  • synteny block?: BlockID0028070
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1190 (alsT)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1310 (alsT)
    08BA02176:
    C248_1393
    11819-97:
    MS7_1314
    71193:
    ST398NM01_1358
    ECT-R 2:
    ECTR2_1214 (agcS)
    ED133:
    SAOV_1368
    ED98:
    SAAV_1337
    HO 5096 0412:
    SAEMRSA15_12040
    JH1:
    SaurJH1_1445
    JH9:
    SaurJH9_1418
    JKD6008:
    SAA6008_01321
    JKD6159:
    SAA6159_01222
    LGA251:
    SARLGA251_12660
    M013:
    M013TW_1303
    MRSA252:
    SAR1368
    MSHR1132:
    SAMSHR1132_12000
    MSSA476:
    SAS1296
    Mu3:
    SAHV_1344 (alsT)
    Mu50:
    SAV1356 (alsT)
    MW2:
    MW1243 (alsT)
    RF122:
    SAB1213
    ST398:
    SAPIG1358
    T0131:
    SAT0131_01427
    TCH60:
    HMPREF0772_11853 (agcS)
    TW20:
    SATW20_13570
    USA300_TCH1516:
    USA300HOU_1290 (alsT)
    VC40:
    SAVC_06025

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKDFDSLIPGWFKEFVHVGTDLIWSQYLIGLLLTAGFFFTISSKFVQLRMLPEMFRALVE
    N315            MKDFDSLIPGWFKEFVHVGTDLIWSQYLIGLLLTAGFFFTISSKFVQLRMLPEMFRALVE
    NCTC8325        MKDFDSLIPGWFKEFVHVGTDLIWSQYLIGLLLTAGFFFTISSKFVQLRMLPEMFRALVE
    Newman          MKDFDSLIPGWFKEFVHVGTDLIWSQYLIGLLLTAGFFFTISSKFVQLRMLPEMFRALVE
    USA300_FPR3757  MKDFDSLIPGWFKEFVHVGTDLIWSQYLIGLLLTAGFFFTISSKFVQLRMLPEMFRALVE
                    ************************************************************

    COL             RPETLEDGKKGISPFQAFAISAGSRVGTGNIAGVATAIVLGGPGAVFWMWVIAFIGAASA
    N315            RPETLEDGKKGISPFQAFAISAGSRVGTGNIAGVATAIVLGGPGAVFWMWVIAFIGAASA
    NCTC8325        RPETLEDGKKGISPFQAFAISAGSRVGTGNIAGVATAIVLGGPGAVFWMWVIAFIGAASA
    Newman          RPETLEDGKKGISPFQAFAISAGSRVGTGNIAGVATAIVLGGPGAVFWMWVIAFIGAASA
    USA300_FPR3757  RPETLEDGKKGISPFQAFAISAGSRVGTGNIAGVATAIVLGGPGAVFWMWVIAFIGAASA
                    ************************************************************

    COL             FIEATLAQVYKVHDKDGGFRGGPAYYITKGLNQKWLGIVFAILITITFAFVFNTVQSNTI
    N315            FIEATLAQVYKVHDKDGGFRGGPAYYITKGLNQKWLGIVFAILITITFAFVFNTVQSNTI
    NCTC8325        FIEATLAQVYKVHDKDGGFRGGPAYYITKGLNQKWLGIVFAILITITFAFVFNTVQSNTI
    Newman          FIEATLAQVYKVHDKDGGFRGGPAYYITKGLNQKWLGIVFAILITITFAFVFNTVQSNTI
    USA300_FPR3757  FIEATLAQVYKVHDKDGGFRGGPAYYITKGLNQKWLGIVFAILITITFAFVFNTVQSNTI
                    ************************************************************

    COL             AESLNTQYNISPVITGIILAIVTAIIIFGGVRSIATLSSLIVPIMAIIYIGMVLVILLFN
    N315            AESLNTQYNISPVITGIILAIVTAIIIFGGVRSIATLSSLIVPIMAIIYIGMVLVILLFN
    NCTC8325        AESLNTQYNISPVITGIILAIVTAIIIFGGVRSIATLSSLIVPIMAIIYIGMVLVILLFN
    Newman          AESLNTQYNISPVITGIILAIVTAIIIFGGVRSIATLSSLIVPIMAIIYIGMVLVILLFN
    USA300_FPR3757  AESLNTQYNISPVITGIILAIVTAIIIFGGVRSIATLSSLIVPIMAIIYIGMVLVILLFN
                    ************************************************************

    COL             LDQIVPMIGTIIKSAFGIEQVTGGAVGAAVLQGIKRGLFSNEAGMGSAPNAAATAAVPHP
    N315            LDQIVPMIGTIIKSAFGIEQVTGGAVGAAVLQGIKRGLFSNEAGMGSAPNAAATAAVPHP
    NCTC8325        LDQIVPMIGTIIKSAFGIEQVTGGAVGAAVLQGIKRGLFSNEAGMGSAPNAAATAAVPHP
    Newman          LDQIVPMIGTIIKSAFGIEQVTGGAVGAAVLQGIKRGLFSNEAGMGSAPNAAATAAVPHP
    USA300_FPR3757  LDQIVPMIGTIIKSAFGIEQVTGGAVGAAVLQGIKRGLFSNEAGMGSAPNAAATAAVPHP
                    ************************************************************

    COL             VKQGLIQSLGVFFDTMLVCTATAIMILLYSGLKFGDNAPQGVAVTQSALNEHLGSAGGIF
    N315            VKQGLIQSLGVFFDTMLVCTATAIMILLYSGLKFGDNAPQGVAVTQSALNEHLGSAGGIF
    NCTC8325        VKQGLIQSLGVFFDTMLVCTATAIMILLYSGLKFGDNAPQGVAVTQSALNEHLGSAGGIF
    Newman          VKQGLIQSLGVFFDTMLVCTATAIMILLYSGLKFGDNAPQGVAVTQSALNEHLGSAGGIF
    USA300_FPR3757  VKQGLIQSLGVFFDTMLVCTATAIMILLYSGLKFGDNAPQGVAVTQSALNEHLGSAGGIF
                    ************************************************************

    COL             LTIAVTLFAFSSVVGNYYYGQSNIEFLSTNRVILFIFRCLVVVLVFVGAVVKTETVWNTA
    N315            LTIAVTLFAFSSVVGNYYYGQSNIEFLSTNRVILFIFRCLVVVLVFVGAVVKTETVWNTA
    NCTC8325        LTIAVTLFAFSSVVGNYYYGQSNIEFLSTNRVILFIFRCLVVVLVFVGAVVKTETVWNTA
    Newman          LTIAVTLFAFSSVVGNYYYGQSNIEFLSTNRVILFIFRCLVVVLVFVGAVVKTETVWNTA
    USA300_FPR3757  LTIAVTLFAFSSVVGNYYYGQSNIEFLSTNRVILFIFRCLVVVLVFVGAVVKTETVWNTA
                    ************************************************************

    COL             DLFMGLMAIVNIISIIGLSNVAFALMKDYQKQKKEGKNPVFKPENLEINLFGISAWGANK
    N315            DLFMGLMAIVNIISIIGLSNVAFALMKDYQKQKKEGKNPVFKPENLEINLFGISAWGANK
    NCTC8325        DLFMGLMAIVNIISIIGLSNVAFALMKDYQKQKKEGKNPVFKPENLEINLFGISAWGANK
    Newman          DLFMGLMAIVNIISIIGLSNVAFALMKDYQKQKKEGKNPVFKPENLEINLFGISAWGANK
    USA300_FPR3757  DLFMGLMAIVNIISIIGLSNVAFALMKDYQKQKKEGKNPVFKPENLEINLFGISAWGANK
                    ************************************************************

    COL             YKNSDKQIFLM
    N315            YKNSDK-----
    NCTC8325        YKNSDK-----
    Newman          YKNSDK-----
    USA300_FPR3757  YKNSDK-----
                    ******