From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN003747000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 4046814..4046976
  • synteny block?: BlockID0028100
  • occurrence?: in 50% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1312
    08BA02176:
    C248_1395
    11819-97:
    71193:
    ST398NM01_2875
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_12060
    JH1:
    SaurJH1_1447
    JH9:
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    SAR1370
    MSHR1132:
    MSSA476:
    SAS1298
    Mu3:
    SAHV_1346
    Mu50:
    SAV1358
    MW2:
    MW1245
    RF122:
    ST398:
    T0131:
    TCH60:
    HMPREF0772_11851
    TW20:
    USA300_TCH1516:
    USA300HOU_1292
    VC40:
    SAVC_06035

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKGLINPKLSVLHGRFVTVKGICMVSLMLVILHKWTVFIQHLMNILSGGESIIE
    N315            ------------------------MVSLMLVILHKWTVFIQHLMNILSGGESIIE
    NCTC8325        MKKGLINPKLSVLHGRFVTVKGICMVSLMLVILHKWTVFIQHLMNILSGGESIIE
                                            *******************************