From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003748000
  • symbol?:
  • description?: AI-2E family transporter

      descriptions from strain specific annotations:

    • AI-2E family transporter
    • Membrane protein YubA
    • membrane protein
    • membrane spanning protein
    • putative transporter
  • strand?: +
  • coordinates?: 4046977..4048185
  • synteny block?: BlockID0028110
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1313 (yrrI)
    08BA02176:
    C248_1396
    11819-97:
    MS7_1316
    71193:
    ST398NM01_1360
    ECT-R 2:
    ECTR2_1216
    ED133:
    SAOV_1370
    ED98:
    SAAV_1339
    HO 5096 0412:
    SAEMRSA15_12070
    JH1:
    SaurJH1_1448
    JH9:
    SaurJH9_1420
    JKD6008:
    SAA6008_01324
    JKD6159:
    SAA6159_01224
    LGA251:
    SARLGA251_12680
    M013:
    M013TW_1305
    MRSA252:
    SAR1371
    MSHR1132:
    SAMSHR1132_12020
    MSSA476:
    SAS1299
    Mu3:
    SAHV_1347
    Mu50:
    SAV1359
    MW2:
    MW1246
    RF122:
    SAB1215
    ST398:
    SAPIG1360
    T0131:
    SAT0131_01431 (dsbA)
    TCH60:
    HMPREF0772_11850
    TW20:
    SATW20_13590
    USA300_TCH1516:
    USA300HOU_1293
    VC40:
    SAVC_06040

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNENEKNIRKNFLKFTESRYMKFVGGNDLVFSLIALVLLGIVIFIFEKVSYVFDPFIIVF
    N315            MNENEKNIRKNFLKFTESRYMKFVGGNDLVFSLIALVLLGIVIFIFEKVSYVFDPFIIVF
    NCTC8325        MNENEKNIRKNFLKFTESRYMKFVGGNDLVFSLIALVLLGIVIFIFEKVSYVFDPFIIVF
    Newman          MNENEKNIRKNFLKFTESRYMKFVGGNDLVFSLIALVLLGIVIFIFEKVSYVFDPFIIVF
    USA300_FPR3757  MNENEKNIRKNFLKFTESRYMKFVGGNDLVFSLIALVLLGIVIFIFEKVSYVFDPFIIVF
                    ************************************************************

    COL             KTIAAPIIVSLILFYLFNPIVNMMERYRIPRVAGISIIYLAVVGVITLIVNLLIPIIGSQ
    N315            KTIAAPIIVSLILFYLFNPIVNMMERYRIPRVAGISIIYLAVVGVITLIVNLLIPIIGSQ
    NCTC8325        KTIAAPIIVSLILFYLFNPIVNMMERYRIPRVAGISIIYLAVVGVITLIVNLLIPIIGSQ
    Newman          KTIAAPIIVSLILFYLFNPIVNMMERYRIPRVAGISIIYLAVVGVITLIVNLLIPIIGSQ
    USA300_FPR3757  KTIAAPIIVSLILFYLFNPIVNMMERYRIPRVAGISIIYLAVVGVITLIVNLLIPIIGSQ
                    ************************************************************

    COL             VDSLVKNSPQYLEKLINSIDKIANNTFFSSYYSQINDWLNSLPKKIPSMLSEFTDGFGSK
    N315            VDSLVKNSPQYLEKLINSIDKIANNTFFSSYYSQINDWLNSLPKKIPSMLSEFTDGFGSK
    NCTC8325        VDSLVKNSPQYLEKLINSIDKIANNTFFSSYYSQINDWLNSLPKKIPSMLSEFTDGFGSK
    Newman          VDSLVKNSPQYLEKLINSIDKIANNTFFSSYYSQINDWLNSLPKKIPSMLSEFTDGFGSK
    USA300_FPR3757  VDSLVKNSPQYLEKLINSIDKIANNTFFSSYYSQINDWLNSLPKKIPSMLSEFTDGFGSK
                    ************************************************************

    COL             IATFAETIANIGVVIVTTPFVLFFMLKDGHHFKEFSTNIMPPKFRKDFHDLLEKMSVQVG
    N315            IATFAETIANIGVVIVTTPFVLFFMLKDGHHFKEFSTNIMPPKFRKDFHDLLEKMSVQVG
    NCTC8325        IATFAETIANIGVVIVTTPFVLFFMLKDGHHFKEFSTNIMPPKFRKDFHDLLEKMSVQVG
    Newman          IATFAETIANIGVVIVTTPFVLFFMLKDGHHFKEFSTNIMPPKFRKDFHDLLEKMSVQVG
    USA300_FPR3757  IATFAETIANIGVVIVTTPFVLFFMLKDGHHFKEFSTNIMPPKFRKDFHDLLEKMSVQVG
                    ************************************************************

    COL             SYIQGQIIVSFCIGILLFIGYSVIGLKYSLVLASIAAVTSVVPYLGPTIAISPAIVIAAI
    N315            SYIQGQIIVSFCIGILLFIGYSVIGLKYSLVLASIAAVTSVVPYLGPTIAISPAIVIAAI
    NCTC8325        SYIQGQIIVSFCIGILLFIGYSVIGLKYSLVLASIAAVTSVVPYLGPTIAISPAIVIAAI
    Newman          SYIQGQIIVSFCIGILLFIGYSVIGLKYSLVLASIAAVTSVVPYLGPTIAISPAIVIAAI
    USA300_FPR3757  SYIQGQIIVSFCIGILLFIGYSVIGLKYSLVLASIAAVTSVVPYLGPTIAISPAIVIAAI
                    ************************************************************

    COL             TSPWMLLKLAVVWTLVQFVEGHFISPNIMGKTLKIHPLTIIFILLCAGKLLGIVGVILGI
    N315            TSPWMLLKLAVVWTLVQFVEGHFISPNIMGKTLKIHPLTIIFILLCAGKLLGIVGVILGI
    NCTC8325        TSPWMLLKLAVVWTLVQFVEGHFISPNIMGKTLKIHPLTIIFILLCAGKLLGIVGVILGI
    Newman          TSPWMLLKLAVVWTLVQFVEGHFISPNIMGKTLKIHPLTIIFILLCAGKLLGIVGVILGI
    USA300_FPR3757  TSPWMLLKLAVVWTLVQFVEGHFISPNIMGKTLKIHPLTIIFILLCAGKLLGIVGVILGI
                    ************************************************************

    COL             PGYAILKVLVTHLFQLFKRRYNRFYGNDVGEYDIKESNKIVE
    N315            PGYAILKVLVTHLFQLFKRRYNRFYGNDVGEYDIKESNKIVE
    NCTC8325        PGYAILKVLVTHLFQLFKRRYNRFYGNDVGEYDIKESNKIVE
    Newman          PGYAILKVLVTHLFQLFKRRYNRFYGNDVGEYDIKESNKIVE
    USA300_FPR3757  PGYAILKVLVTHLFQLFKRRYNRFYGNDVGEYDIKESNKIVE
                    ******************************************