From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003751000
  • symbol?: msrR
  • description?: peptide methionine sulfoxide reductase

      descriptions from strain specific annotations:

    • peptide methionine sulfoxide reductase
    • cell envelope-related transcriptional attenuator
    • LytR family transcriptional regulator
    • transcriptional regulator, putative
    • Peptide methionine sulfoxide reductase regulator MsrR
    • cell envelope-related function transcriptional attenuator common domain-containing protein
    • peptide methionine sulfoxide reductase regulator
    • regulatory protein msrR
    • transcriptional attenuator MsrR
    • cell envelope transcriptional attenuator
    • Protein MsrR
  • strand?: +
  • coordinates?: 4052254..4053237
  • synteny block?: BlockID0028140
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1195 (msrR)
    NCTC8325:
    Newman:
    NWMN_1274 (msrR)
    USA300_FPR3757:
    04-02981:
    SA2981_1316 (msrR)
    08BA02176:
    C248_1399 (msrR)
    11819-97:
    MS7_1319 (msrR)
    71193:
    ST398NM01_1363
    ECT-R 2:
    ECTR2_1219
    ED133:
    SAOV_1373
    ED98:
    SAAV_1342
    HO 5096 0412:
    SAEMRSA15_12100
    JH1:
    SaurJH1_1451
    JH9:
    SaurJH9_1423
    JKD6008:
    SAA6008_01327 (msrR)
    JKD6159:
    SAA6159_01227 (msrR)
    LGA251:
    SARLGA251_12710 (msrR)
    M013:
    M013TW_1308
    MRSA252:
    SAR1374
    MSHR1132:
    SAMSHR1132_12050
    MSSA476:
    SAS1302
    Mu3:
    SAHV_1350 (msrR)
    Mu50:
    SAV1362 (msrR)
    MW2:
    MW1249 (msrR)
    RF122:
    SAB1218
    ST398:
    SAPIG1363
    T0131:
    SAT0131_01434 (fmhA)
    TCH60:
    HMPREF0772_11847 (msrR)
    TW20:
    SATW20_13620 (msrR)
    USA300_TCH1516:
    USA300HOU_1296 (msrR)
    VC40:
    SAVC_06055

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDKETNDNEYRRQSEHRTSAPKRKKKKKIRKLPIILLIVVILLIALVVYIVHSYNSGVEY
    N315            MDKETNDNEYRRQSEHRTSAPKRKKKKKIRKLPIILLIVVILLIALVVYIVHSYNSGVEY
    NCTC8325        MDKETNDNEYRRQSEHRTSAPKRKKKKKIRKLPIILLIVVILLIALVVYIVHSYNSGVEY
    Newman          MDKETNDNEYRRQSEHRTSAPKRKKKKKIRKLPIILLIVVILLIALVVYIVHSYNSGVEY
    USA300_FPR3757  MDKETNDNEYRRQSEHRTSAPKRKKKKKIRKLPIILLIVVILLIALVVYIVHSYNSGVEY
                    ************************************************************

    COL             AKKHAKDVKVHQFNGPVKNDGKISILVLGADKAQGGQSRTDSIMVVQYDFINKKMKMMSV
    N315            AKKHAKDVKVHQFNGPVKNDGKISILVLGADKAQGGQSRTDSIMVVQYDFINKKMKMMSV
    NCTC8325        AKKHAKDVKVHQFNGPVKNDGKISILVLGADKAQGGQSRTDSIMVVQYDFINKKMKMMSV
    Newman          AKKHAKDVKVHQFNGPVKNDGKISILVLGADKAQGGQSRTDSIMVVQYDFINKKMKMMSV
    USA300_FPR3757  AKKHAKDVKVHQFNGPVKNDGKISILVLGADKAQGGQSRTDSIMVVQYDFINKKMKMMSV
                    ************************************************************

    COL             MRDIYADIPGYGKHKINSAYALGGPELLRKTLDKNLGINPEYYAVVDFTGFEKMIDELMP
    N315            MRDIYADIPGYGKHKINSAYALGGPELLRKTLDKNLGINPEYYAVVDFTGFEKMIDELMP
    NCTC8325        MRDIYADIPGYGKHKINSAYALGGPELLRKTLDKNLGINPEYYAVVDFTGFEKMIDELMP
    Newman          MRDIYADIPGYGKHKINSAYALGGPELLRKTLDKNLGINPEYYAVVDFTGFEKMIDELMP
    USA300_FPR3757  MRDIYADIPGYGKHKINSAYALGGPELLRKTLDKNLGINPEYYAVVDFTGFEKMIDELMP
                    ************************************************************

    COL             EGVPINVEKDMSKNIGVSLKKGNHRLNGKELLGYARFRHDPEGDFGRVRRQQQVMQTLKK
    N315            EGVPINVEKDMSKNIGVSLKKGNHRLNGKELLGYARFRHDPEGDFGRVRRQQQVMQTLKK
    NCTC8325        EGVPINVEKDMSKNIGVSLKKGNHRLNGKELLGYARFRHDPEGDFGRVRRQQQVMQTLKK
    Newman          EGVPINVEKDMSKNIGVSLKKGNHRLNGKELLGYARFRHDPEGDFGRVRRQQQVMQTLKK
    USA300_FPR3757  EGVPINVEKDMSKNIGVSLKKGNHRLNGKELLGYARFRHDPEGDFGRVRRQQQVMQTLKK
                    ************************************************************

    COL             EMVNFRTVVKLPKVAGILRGYVNTNIPDSGIFQTGLSFGIRGEKDVKSLTVPIKNSYEDV
    N315            EMVNFRTVVKLPKVAGILRGYVNTNIPDSGIFQTGLSFGIRGEKDVKSLTVPIKNSYEDV
    NCTC8325        EMVNFRTVVKLPKVAGILRGYVNTNIPDSGIFQTGLSFGIRGEKDVKSLTVPIKNSYEDV
    Newman          EMVNFRTVVKLPKVAGILRGYVNTNIPDSGIFQTGLSFGIRGEKDVKSLTVPIKNSYEDV
    USA300_FPR3757  EMVNFRTVVKLPKVAGILRGYVNTNIPDSGIFQTGLSFGIRGEKDVKSLTVPIKNSYEDV
                    ************************************************************

    COL             NTNTDGSALQINKNTNKQAIKDFLDED
    N315            NTNTDGSALQINKNTNKQAIKDFLDED
    NCTC8325        NTNTDGSALQINKNTNKQAIKDFLDED
    Newman          NTNTDGSALQINKNTNKQAIKDFLDED
    USA300_FPR3757  NTNTDGSALQINKNTNKQAIKDFLDED
                    ***************************