From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003757000
  • symbol?:
  • description?: DNA repair protein MucB

      descriptions from strain specific annotations:

    • DNA repair protein MucB
    • ImpB/MucB/SamB family protein
    • ImpB/MucB/SamB family DNA-damage repair protein
    • DNA-damage repair protein
    • DNA-directed DNA polymerase
    • pseudogene
  • strand?: +
  • coordinates?: 4055605..4056867
  • synteny block?: BlockID0028200
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1318
    08BA02176:
    C248_1402
    11819-97:
    MS7_1321
    71193:
    ST398NM01_1365
    ECT-R 2:
    ECTR2_1221
    ED133:
    SAOV_1374
    ED98:
    SAAV_1344
    HO 5096 0412:
    SAEMRSA15_12120
    JH1:
    SaurJH1_1454
    JH9:
    SaurJH9_1425
    JKD6008:
    SAA6008_01329
    JKD6159:
    SAA6159_01229
    LGA251:
    SARLGA251_12730
    M013:
    M013TW_1310
    MRSA252:
    SAR1377
    MSHR1132:
    SAMSHR1132_12070
    MSSA476:
    SAS1304
    Mu3:
    SAHV_1352
    Mu50:
    SAV1364
    MW2:
    MW1251
    RF122:
    SAB1219
    ST398:
    SAPIG1365
    T0131:
    SAT0131_01436
    TCH60:
    HMPREF0772_11843 (dinB2)
    TW20:
    SATW20_13640
    USA300_TCH1516:
    USA300HOU_1299
    VC40:
    SAVC_06070

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MYNYHLLEDRDVLCIDQKSFFASVSCIEKGLDPLETKLAVVADTKRQGSVILAATPKLKE
    N315            MYNYHLLEDRDVLCIDQKSFFASVSCIEKGLDPLETKLAVVADTKRQGSVILAATPKLKE
    NCTC8325        MYNYHLLEDRDVLCIDQKSFFASVSCIEKGLDPLETKLAVVADTKRQGSVILAATPKLKE
    Newman          MYNYHLLEDRDVLCIDQKSFFASVSCIEKGLDPLETKLAVVADTKRQGSVILAATPKLKE
    USA300_FPR3757  MYNYHLLEDRDVLCIDQKSFFASVSCIEKGLDPLETKLAVVADTKRQGSVILAATPKLKE
                    ************************************************************

    COL             LGIKTGSRLFEIPHRNDIYIINPSMRKYLNVSVAISKIALRYIPPEDLHQYSIDEFFMDV
    N315            LGIKTGSRLFEIPHRNDIYIINPSMRKYLNVSVAISKIALRYIPPEDLHQYSIDEFFMDV
    NCTC8325        LGIKTGSRLFEIPHRNDIYIINPSMRKYLNVSVAISKIALRYIPPEDLHQYSIDEFFMDV
    Newman          LGIKTGSRLFEIPHRNDIYIINPSMRKYLNVSVAISKIALRYIPPEDLHQYSIDEFFMDV
    USA300_FPR3757  LGIKTGSRLFEIPHRNDIYIINPSMRKYLNVSVAISKIALRYIPPEDLHQYSIDEFFMDV
                    ************************************************************

    COL             TDSYHRFSSTVHAFCERLKREIYEETGIYCTVGIGSNMLLSKIAMDVEAKHSQNGIAEWR
    N315            TDSYHRFSSTVHAFCERLKREIYEETGIYCTVGIGSNMLLSKIAMDVEAKHSQNGIAEWR
    NCTC8325        TDSYHRFSSTVHAFCERLKREIYEETGIYCTVGIGSNMLLSKIAMDVEAKHSQNGIAEWR
    Newman          TDSYHRFSSTVHAFCERLKREIYEETGIYCTVGIGSNMLLSKIAMDVEAKHSQNGIAEWR
    USA300_FPR3757  TDSYHRFSSTVHAFCERLKREIYEETGIYCTVGIGSNMLLSKIAMDVEAKHSQNGIAEWR
                    ************************************************************

    COL             YQDVPTKLWPIQPLRDFWGINRRTEAKLNKRGIFTIGDLAKYPYKFLKKEFGILGVDMHL
    N315            YQDVPTKLWPIQPLRDFWGINRRTEAKLNKRGIFTIGDLAKYPYKFLKKEFGILGVDMHL
    NCTC8325        YQDVPTKLWPIQPLRDFWGINRRTEAKLNKRGIFTIGDLAKYPYKFLKKEFGILGVDMHL
    Newman          YQDVPTKLWPIQPLRDFWGINRRTEAKLNKRGIFTIGDLAKYPYKFLKKEFGILGVDMHL
    USA300_FPR3757  YQDVPTKLWPIQPLRDFWGINRRTEAKLNKRGIFTIGDLAKYPYKFLKKEFGILGVDMHL
                    ************************************************************

    COL             HANGIDQSKVREKHKISNPSICKSQILMRDYHFDEAKVVMQELIEDVASRVRARKKVART
    N315            HANGIDQSKVREKHKISNPSICKSQILMRDYHFDEAKVVMQELIEDVASRVRARKKVART
    NCTC8325        HANGIDQSKVREKHKISNPSICKSQILMRDYHFDEAKVVMQELIEDVASRVRARKKVART
    Newman          HANGIDQSKVREKHKISNPSICKSQILMRDYHFDEAKVVMQELIEDVASRVRARKKVART
    USA300_FPR3757  HANGIDQSKVREKHKISNPSICKSQILMRDYHFDEAKVVMQELIEDVASRVRARKKVART
                    ************************************************************

    COL             IHFAFGYSDEGGVHKQYTLKDPTNLEKDIYKVVMHFADKLCNKQALYRTLSISLSQFINE
    N315            IHFAFGYSDEGGVHKQYTLKDPTNLEKDIYKVVMHFADKLCNKQALYRTLSISLSQFINE
    NCTC8325        IHFAFGYSDEGGVHKQYTLKDPTNLEKDIYKVVMHFADKLCNKQALYRTLSISLSQFINE
    Newman          IHFAFGYSDEGGVHKQYTLKDPTNLEKDIYKVVMHFADKLCNKQALYRTLSISLSQFINE
    USA300_FPR3757  IHFAFGYSDEGGVHKQYTLKDPTNLEKDIYKVVMHFADKLCNKQALYRTLSISLSQFINE
                    ************************************************************

    COL             DERQLSLFEDEYQRKRDECLAKTIDQLHLKYGKGIVSKAVSFTEAGTKHGRLGLMAGHKM
    N315            DERQLSLFEDEYQRKRDECLAKTIDQLHLKYGKGIVSKAVSFTEAGTKHGRLGLMAGHKM
    NCTC8325        DERQLSLFEDEYQRKRDECLAKTIDQLHLKYGKGIVSKAVSFTEAGTKHGRLGLMAGHKM
    Newman          DERQLSLFEDEYQRKRDECLAKTIDQLHLKYGKGIVSKAVSFTEAGTKHGRLGLMAGHKM
    USA300_FPR3757  DERQLSLFEDEYQRKRDECLAKTIDQLHLKYGKGIVSKAVSFTEAGTKHGRLGLMAGHKM
                    ************************************************************