From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003759000
  • symbol?:
  • description?: aminopeptidase

      descriptions from strain specific annotations:

    • aminopeptidase
    • glutamyl aminopeptidase
    • putative glutamyl aminopeptidase
    • Deblocking aminopeptidase
    • glutamyl aminopeptidase, putative
    • M42 family peptidase
    • M42 glutamyl aminopeptidase family protein
    • peptidase, family M20/M25/M40 protein
    • peptidase M42 family protein
    • putative peptidase
    • simila to deblocking aminopeptidase
  • strand?: +
  • coordinates?: 4058269..4059300
  • synteny block?: BlockID0028220
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1320
    08BA02176:
    C248_1404
    11819-97:
    MS7_1323
    71193:
    ST398NM01_1367
    ECT-R 2:
    ECTR2_1223
    ED133:
    SAOV_1376
    ED98:
    SAAV_1346
    HO 5096 0412:
    SAEMRSA15_12140
    JH1:
    SaurJH1_1456
    JH9:
    SaurJH9_1427
    JKD6008:
    SAA6008_01331
    JKD6159:
    SAA6159_01232
    LGA251:
    SARLGA251_12750
    M013:
    M013TW_1312
    MRSA252:
    SAR1379
    MSHR1132:
    SAMSHR1132_12090
    MSSA476:
    SAS1306
    Mu3:
    SAHV_1354
    Mu50:
    SAV1366
    MW2:
    MW1253
    RF122:
    SAB1221
    ST398:
    SAPIG1367
    T0131:
    SAT0131_01438
    TCH60:
    HMPREF0772_11841
    TW20:
    SATW20_13660
    USA300_TCH1516:
    USA300HOU_1301
    VC40:
    SAVC_06080

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEPILEMIKTLTGINSPSGDTEEAIQFVEKYAKDLGYQTTLTNKGALLITVPGKNDEVQR
    N315            MEPILEMIKTLTGINSPSGDTEEAIQFVEKYAKDLGYQTTLTNKGALLITVPGKNDEVQR
    NCTC8325        MEPILEMIKTLTGINSPSGDTEEAIQFVEKYAKDLGYQTTLTNKGALLITVPGKNDEVQR
    Newman          MEPILEMIKTLTGINSPSGDTEEAIQFVEKYAKDLGYQTTLTNKGALLITVPGKNDEVQR
    USA300_FPR3757  MEPILEMIKTLTGINSPSGDTEEAIQFVEKYAKDLGYQTTLTNKGALLITVPGKNDEVQR
                    ************************************************************

    COL             CITAHVDTLGAMVKEIKEDGRLAIELIGGFTYNAIEGEYCQIKTDAGQIYTGTICLHETS
    N315            CITAHVDTLGAMVKEIKEDGRLAIELIGGFTYNAIEGEYCQIKTDAGQIYTGTICLHETS
    NCTC8325        CITAHVDTLGAMVKEIKEDGRLAIELIGGFTYNAIEGEYCQIKTDAGQIYTGTICLHETS
    Newman          CITAHVDTLGAMVKEIKEDGRLAIELIGGFTYNAIEGEYCQIKTDAGQIYTGTICLHETS
    USA300_FPR3757  CITAHVDTLGAMVKEIKEDGRLAIELIGGFTYNAIEGEYCQIKTDAGQIYTGTICLHETS
                    ************************************************************

    COL             VHVYRNNHEIPRDQKHMEIRIDEVTTSEEDTKSLGISVGNFVSFDPRTVITSSGFIKSRH
    N315            VHVYRNNHEIPRDQKHMEIRIDEVTTSEEDTKSLGISVGDFVSFDPRTVITSSGFIKSRH
    NCTC8325        VHVYRNNHEIPRDQKHMEIRIDEVTTSEEDTKSLGISVGDFVSFDPRTVITSSGFIKSRH
    Newman          VHVYRNNHEIPRDQKHMEIRIDEVTTSEEDTKSLGISVGNFVSFDPRTVITSSGFIKSRH
    USA300_FPR3757  VHVYRNNHEIPRDQKHMEIRIDEVTTSEEDTKSLGISVGNFVSFDPRTVITSSGFIKSRH
                    ***************************************:********************

    COL             LDDKASVAMILQLLKKLKEEQIILPHTTQFYISNNEEIGYGANASIDSKIKEYIALDMGA
    N315            LDDKASVAMILQLLKKLKEEQIILPHTTQFYISNNEEIGYGANASIDSKIKEYIALDMGA
    NCTC8325        LDDKASVAMILQLLKKLKEEQIILPHTTQFYISNNEEIGYGANASIDSKIKEYIALDMGA
    Newman          LDDKASVAMILQLLKKLKEEQIILPHTTQFYISNNEEIGYGANASIDSKIKEYIALDMGA
    USA300_FPR3757  LDDKASVAMILQLLKKLKEEQIILPHTTQFYISNNEEIGYGANASIDSKIKEYIALDMGA
                    ************************************************************

    COL             LGDGQASDEYTVSICAKDASGPYHKQLKSHLVNLCKINNIPYKVDIYPYYGSDASAALHA
    N315            LGDGQASDEYTVSICAKDASGPYHKQLKSHLVNLCKINNIPYKVDIYPYYGSDASAALHA
    NCTC8325        LGDGQASDEYTVSICAKDASGPYHKQLKSHLVNLCKINNIPYKVDIYPYYGSDASAALHA
    Newman          LGDGQASDEYTVSICAKDASGPYHKQLKSHLVNLCKINNIPYKVDIYPYYGSDASAALHA
    USA300_FPR3757  LGDGQASDEYTVSICAKDASGPYHKQLKSHLVNLCKINNIPYKVDIYPYYGSDASAALHA
                    ************************************************************

    COL             GADIRHGLFGAGIESSHAMERTHIDSIKATEKLLYAYCLSPIE
    N315            GADIRHGLFGAGIESSHAMERTHIDSIKATEKLLYAYCLSPIE
    NCTC8325        GADIRHGLFGAGIESSHAMERTHIDSIKATEKLLYAYCLSPIE
    Newman          GADIRHGLFGAGIESSHAMERTHIDSIKATEKLLYAYCLSPIE
    USA300_FPR3757  GADIRHGLFGAGIESSHAMERTHIDSIKATEKLLYAYCLSPIE
                    *******************************************