From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003767000
  • symbol?: trpB
  • description?: tryptophan synthase subunit beta

      descriptions from strain specific annotations:

    • tryptophan synthase subunit beta
    • Tryptophan synthase beta chain
    • pseudogene
    • tryptophan synthase, beta subunit
  • strand?: +
  • coordinates?: 4064183..4065398
  • synteny block?: BlockID0028290
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1408 (trpB)
    N315:
    SA1204 (trpB)
    NCTC8325:
    Newman:
    NWMN_1284 (trpB)
    USA300_FPR3757:
    04-02981:
    SA2981_1326 (trpB)
    08BA02176:
    C248_1410 (trpB)
    11819-97:
    MS7_1329 (trpB)
    71193:
    ST398NM01_1373
    ECT-R 2:
    ECTR2_1229 (trpB)
    ED133:
    SAOV_1382
    ED98:
    SAAV_1354 (trpB)
    HO 5096 0412:
    SAEMRSA15_12200 (trpB)
    JH1:
    SaurJH1_1462
    JH9:
    SaurJH9_1433
    JKD6008:
    SAA6008_01337 (trpB)
    JKD6159:
    SAA6159_01238 (trpB)
    LGA251:
    SARLGA251_12810 (trpB)
    M013:
    M013TW_1318
    MRSA252:
    SAR1385 (trpB)
    MSHR1132:
    SAMSHR1132_12150
    MSSA476:
    SAS1312
    Mu3:
    SAHV_1360 (trpB)
    Mu50:
    SAV1372 (trpB)
    MW2:
    MW1259 (trpB)
    RF122:
    SAB1227 (trpB)
    ST398:
    SAPIG1373 (trpB)
    T0131:
    SAT0131_01444 (hlgA)
    TCH60:
    HMPREF0772_11835 (trpB)
    TW20:
    SATW20_13720 (trpB)
    USA300_TCH1516:
    USA300HOU_1307 (trpB)
    VC40:
    SAVC_06110

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKQIQTEADELGFFGEYGGQYVPETLMPAIIELKKAYKEAKADPEFQRELEYYLSEYVG
    N315            MNKQIQTEADELGFFGEYGGQYVPETLMPAIIELKKAYKEAKADPEFQRELEYYLSEYVG
    NCTC8325        MNKQIQTEADELGFFGEYGGQYVPETLMPAIIELKKAYKEAKADPEFQRELEYYLSEYVG
    Newman          MNKQIQTEADELGFFGEYGGQYVPETLMPAIIELKKAYKEAKADPEFQRELEYYLSEYVG
    USA300_FPR3757  MNKQIQTEADELGFFGEYGGQYVPETLMPAIIELKKAYKEAKADPEFQRELEYYLSEYVG
                    ************************************************************

    COL             RATPLTYAASYTESLGGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGAG
    N315            RATPLTYAASYTESLGGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGAG
    NCTC8325        RATPLTYAASYTESLGGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGAG
    Newman          RATPLTYAASYTESLGGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGAG
    USA300_FPR3757  RATPLTYAASYTESLGGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGAG
                    ************************************************************

    COL             QHGVASATVAALFDMELVVFMGSEDIKRQQLNVFRMELLGAKVVAVEDGQGTLSDAVNKA
    N315            QHGVASATVAALFDMELVVFMGSEDIKRQQLNVFRMELLGAKVVAVEEGQGTLSDAVNKA
    NCTC8325        QHGVASATVAALFDMELVVFMGSEDIKRQQLNVFRMELLGAKVVAVEDGQGTLSDAVNKA
    Newman          QHGVASATVAALFDMELVVFMGSEDIKRQQLNVFRMELLGAKVVAVEDGQGTLSDAVNKA
    USA300_FPR3757  QHGVASATVAALFDMELVVFMGSEDIKRQQLNVFRMELLGAKVVAVEDGQGTLSDAVNKA
                    ***********************************************:************

    COL             LQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGKEIKSQILKKEGRLPDAIVACIGG
    N315            LQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGKEIKSQILKKEGRLPDAIVACIGG
    NCTC8325        LQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGKEIKSQILKKEGRLPDAIVACIGG
    Newman          LQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGKEIKSQILKKEGRLPDAIVACIGG
    USA300_FPR3757  LQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGKEIKSQILKKEGRLPDAIVACIGG
                    ************************************************************

    COL             GSNAIGTFYPFIKDDVALYGVEAAGQGDDTDKHALAIGKGSPGVLHGTKMYLIQDEDGQV
    N315            GSNAIGTFYPFIKDDVALYGVEAAGQGEDTDKHALAIGKGSPGVLHGTKMYLIQDEGGQV
    NCTC8325        GSNAIGTFYPFIKDDVALYGVEAAGQGDDTDKHALAIGKGSPGVLHGTKMYLIQDEDGQV
    Newman          GSNAIGTFYPFIKDDVALYGVEAAGQGDDTDKHALAIGKGSPGVLHGTKMYLIQDEDGQV
    USA300_FPR3757  GSNAIGTFYPFIKDDVALYGVEAAGQGDDTDKHALAIGKGSPGVLHGTKMYLIQDEDGQV
                    ***************************:****************************.***

    COL             QLAHSISAGLDYPGIGPEHSYYHDIGRVTFENASDTQAMNALINFTKHEGIIPAIESAHA
    N315            QLAHSISAGLDYPGIGPEHSYYHDIGRVTFENASDTQAMNALINFTKHEGIIPAIESAHA
    NCTC8325        QLAHSISAGLDYPGIGPEHSYYHDIGRVTFENASDTQAMNALINFTKHEGIIPAIESAHA
    Newman          QLAHSISAGLDYPGIGPEHSYYHDIGRVTFENASDTQAMNALINFTKHEGIIPAIESAHA
    USA300_FPR3757  QLAHSISAGLDYPGIGPEHSYYHDIGRVTFENASDTQAMNALINFTKHEGIIPAIESAHA
                    ************************************************************

    COL             LSYVERLAPTMSKEDIIVVTISGRGDKDMETIRQYMVERGLAND
    N315            LSYVERLAPTMSKEDIIVVTISGRGDKDMETIRQYMAERGLAND
    NCTC8325        LSYVERLAPTMSKEDIIVVTISGRGDKDMETIRQYMVERGLAND
    Newman          LSYVERLAPTMSKEDIIVVTISGRGDKDMETIRQYMVERGLAND
    USA300_FPR3757  LSYVERLAPTMSKEDIIVVTISGRGDKDMETIRQYMVERGLAND
                    ************************************.*******