From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003782000
  • symbol?:
  • description?: SWIM zinc finger domain-containing protein

      descriptions from strain specific annotations:

    • SWIM zinc finger domain-containing protein
    • zinc finger SWIM domain-containing protein
    • SWIM zinc finger family protein
    • transcriptional regulator
    • pseudogene
  • strand?: -
  • coordinates?: 4077242..4077692
  • synteny block?: BlockID0028390
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1332
    08BA02176:
    C248_1415
    11819-97:
    MS7_1335
    71193:
    ST398NM01_1378
    ECT-R 2:
    ECTR2_1235
    ED133:
    SAOV_1387c
    ED98:
    SAAV_1360
    HO 5096 0412:
    SAEMRSA15_12420
    JH1:
    SaurJH1_1468
    JH9:
    SaurJH9_1439
    JKD6008:
    SAA6008_01342
    JKD6159:
    SAA6159_01245
    LGA251:
    SARLGA251_12950
    M013:
    M013TW_1323
    MRSA252:
    SAR1391
    MSHR1132:
    SAMSHR1132_12200
    MSSA476:
    SAS1319
    Mu3:
    SAHV_1366
    Mu50:
    SAV1378
    MW2:
    MW1266
    RF122:
    SAB1233c
    ST398:
    SAPIG1378
    T0131:
    SAT0131_01449
    TCH60:
    HMPREF0772_11830
    TW20:
    SATW20_13770
    USA300_TCH1516:
    USA300HOU_1312
    VC40:
    SAVC_06135

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGLLDIASIRSIERGFNYYQSECVINLKSFSETQHEAEVKGSGNKVYRCYIDMEHPRKSI
    N315            MGLLDIASIRSIERGFNYYQSECVINLKSFSETQHEAEVKGSGNKVYRCYIDMEHPRKSK
    NCTC8325        MGLLDIASIRSIERGFNYYQSECVINLKSFSETQHEAEVKGSGNKVYRCYIDMEHPRKSI
    Newman          MGLLDIASIRSIERGFNYYQSECVINLKSFSETQHEAEVKGSGNKVYRCYIDMEHPRKSI
    USA300_FPR3757  MGLLDIASIRSIERGFNYYQSECVINLKSFSETQHEAEVKGSGNKVYRCYIDMEHPRKSI
                    *********************************************************** 

    COL             CNCPHADGRRVICKHMIALLFTASPEAANKHIMMLNEVEEDYQLRRNMWIDSLKEMINDM
    N315            CNCPHADGRRVICKHMIALLFTASPEAANKHIMMLNEVEEDYQLRRNMWIDSLKEMINDM
    NCTC8325        CNCPHADGRRVICKHMIALLFTASPEAANKHIMMLNEVEEDYQLRRNMWIDSLKEMINDM
    Newman          CNCPHADGRRVICKHMIALLFTASPEAANKHIMMLNEVEEDYQLRRNMWIDSLKEMINDM
    USA300_FPR3757  CNCPHADGRRVICKHMIALLFTASPEAANKHIMMLNEVEEDYQLRRNMWIDSLKEMINDM
                    ************************************************************

    COL             SEEELRDAYLNMLIEHGEMAELFGLDEEEEMFEDEFY
    N315            SEEELRDAYLNMLIEHGEMAELFGLDEEEEMFEDEFY
    NCTC8325        SEEELRDAYLNMLIEHGEMAELFGLDEEEEMFEDEFY
    Newman          SEEELRDAYLNMLIEHGEMAELFGLDEEEEMFEDEFY
    USA300_FPR3757  SEEELRDAYLNMLIEHGEMAELFGLDEEEEMFEDEFY
                    *************************************