From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003785000
  • symbol?: opp-2D
  • description?: peptide ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • peptide ABC transporter ATP-binding protein
    • oligopeptide transport ATPase
    • oligopeptide transporter ATPase
    • ABC superfamily ATP binding cassette transporter, ABC protein
    • ABC transporter
    • ABC transporter family protein
    • ABC-type dipeptide/oligopeptide/nickel transporter, ATPase component 2
    • ABC-type dipeptide/oligopeptide/nickel transport system, ATP-binding protein
    • dipeptide/oligopeptide/nickel ABC transporter ATP-binding protein
    • nickel transport ATP-binding protein
    • oligopeptide ABC transporter ATP-binding protein
    • Putative oligopeptide transport ATP-binding protein oppD2
    • putative oligopeptide transporter ATPase
  • strand?: -
  • coordinates?: 4078774..4080175
  • synteny block?: BlockID0028420
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1212 (opp-2D)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1334 (opp-2D)
    08BA02176:
    C248_1417
    11819-97:
    MS7_1337
    71193:
    ST398NM01_1380
    ECT-R 2:
    ECTR2_1237
    ED133:
    SAOV_1389c
    ED98:
    SAAV_1362
    HO 5096 0412:
    SAEMRSA15_12440
    JH1:
    SaurJH1_1470
    JH9:
    SaurJH9_1441
    JKD6008:
    SAA6008_01344 (nikD)
    JKD6159:
    SAA6159_01247 (nikD)
    LGA251:
    SARLGA251_12970
    M013:
    M013TW_1325
    MRSA252:
    SAR1393
    MSHR1132:
    SAMSHR1132_12220
    MSSA476:
    SAS1321
    Mu3:
    SAHV_1368
    Mu50:
    SAV1380
    MW2:
    MW1268 (opp-2D)
    RF122:
    SAB1235c
    ST398:
    SAPIG1380
    T0131:
    SAT0131_01451
    TCH60:
    HMPREF0772_11828 (oppD)
    TW20:
    SATW20_13790
    USA300_TCH1516:
    USA300HOU_1314
    VC40:
    SAVC_06145

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSLIDIQNLTIKNTSEKSLIKGIDLKIFSQQINALIGESGAGKSLIAKALLEYLPFDLSC
    N315            MSLIDIQNLTIKNTCEKYLIKGIDLKIFSQQINALIGESGAGKSLIAKALLEYLPFDLSC
    NCTC8325        MSLIDIQNLTIKNTSEKSLIKGIDLKIFSQQINALIGESGAGKSLIAKALLEYLPFDLSC
    Newman          MSLIDIQNLTIKNTSEKSLIKGIDLKIFSQQINALIGESGAGKSLIAKALLEYLPFDLSC
    USA300_FPR3757  MSLIDIQNLTIKNTSEKSLIKGIDLKIFSQQINALIGESGAGKSLIAKALLEYLPFDLSC
                    **************.** ******************************************

    COL             TYDSYQFDGENVSRLSQYYGHTIGYISQNYAESFNDHTKLGKQLTAIYRKHYKGSKEEAL
    N315            TYDSYQFDGENISRLSQYYGHTIGYISQNYAESFNDHTKLGKQLTAIYRKHYKSSKEEAL
    NCTC8325        TYDSYQFDGENVSRLSQYYGHTIGYISQNYAESFNDHTKLGKQLTAIYRKHYKGSKEEAL
    Newman          TYDSYQFDGENVSRLSQYYGHTIGYISQNYAESFNDHTKLGKQLTAIYRKHYKGSKEEAL
    USA300_FPR3757  TYDSYQFDGENVSRLSQYYGHTIGYISQNYAESFNDHTKLGKQLTAIYRKHYKGSKEEAL
                    ***********:*****************************************.******

    COL             SKVDKALSWVNLQSKDILNKYSFQLSGGQLERVYIASVLMLEPKLIIADEPVASLDALNG
    N315            SKIDKALSWVNLQSKDILNKYSFQLSGGQLERVYIASVLMLEPKLIIADEPVASLDALNG
    NCTC8325        SKVDKALSWVNLQSKDILNKYSFQLSGGQLERVYIASVLMLEPKLIIADEPVASLDALNG
    Newman          SKVDKALSWVNLQSKDILNKYSFQLSGGQLERVYIASVLMLEPKLIIADEPVASLDALNG
    USA300_FPR3757  SKVDKALSWVNLQSKDILNKYSFQLSGGQLERVYIASVLMLEPKLIIADEPVASLDALNG
                    **:*********************************************************

    COL             NQVMDLLQHIVLEHGQTLFIITHNLSHVLKYCQYIYVLKEGQIIERGNINHFKYEHLHPY
    N315            NQVMDLLQHIVLEHGQTLFIITHNLSHVLKYCQYIYVLKEGQIIERGNINHFKYEHLHPY
    NCTC8325        NQVMDLLQHIVLEHGQTLFIITHNLSHVLKYCQYIYVLKEGQIIERGNINHFKYEHLHPY
    Newman          NQVMDLLQHIVLEHGQTLFIITHNLSHVLKYCQYIYVLKEGQIIERGNINHFKYEHLHPY
    USA300_FPR3757  NQVMDLLQHIVLEHGQTLFIITHNLSHVLKYCQYIYVLKEGQIIERGNINHFKYEHLHPY
                    ************************************************************

    COL             TERLIKYRTQLKRDYYD
    N315            TERLIKYRTQLKRDYYD
    NCTC8325        TERLIKYRTQLKRDYYD
    Newman          TERLIKYRTQLKRDYYD
    USA300_FPR3757  TERLIKYRTQLKRDYYD
                    *****************