From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003789000
  • symbol?:
  • description?: conserved NfeD-like membrane protein

      descriptions from strain specific annotations:

    • conserved NfeD-like membrane protein
    • Permease
  • strand?: -
  • coordinates?: 4083566..4083910
  • synteny block?: BlockID0028460
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1337
    08BA02176:
    C248_1420
    11819-97:
    MS7_1340
    71193:
    ST398NM01_1383
    ECT-R 2:
    ECTR2_1240
    ED133:
    SAOV_1392c
    ED98:
    SAAV_1365
    HO 5096 0412:
    SAEMRSA15_12470
    JH1:
    SaurJH1_1473
    JH9:
    SaurJH9_1444
    JKD6008:
    SAA6008_01347
    JKD6159:
    SAA6159_01250
    LGA251:
    SARLGA251_13000
    M013:
    M013TW_1328
    MRSA252:
    SAR1396
    MSHR1132:
    SAMSHR1132_12250
    MSSA476:
    SAS1324
    Mu3:
    SAHV_1371
    Mu50:
    SAV1383
    MW2:
    MW1271
    RF122:
    SAB1239c
    ST398:
    SAPIG1383
    T0131:
    SAT0131_01454
    TCH60:
    HMPREF0772_11825
    TW20:
    SATW20_13820
    USA300_TCH1516:
    USA300HOU_1317
    VC40:
    SAVC_06160

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTLFDMPNYLWITTLIMILLTIFCCLVLNKWFVSAVITFVILGVLAFFIPNFQDIKYQPL
    N315            MTLFDMPNYLWITTLIMILLTIFCCLVLNKWFVSAVITFVILGVLAFFIPNFQDIKYQPL
    NCTC8325        MTLFDMPNYLWITTLIMILLTIFCCLVLNKWFVSAVITFVILGVLAFFIPNFQDIKYQPL
    Newman          MTLFDMPNYLWITTLIMILLTIFCCLVLNKWFVSAVITFVILGVLAFFIPNFQDIKYQPL
    USA300_FPR3757  MTLFDMPNYLWITTLIMILLTIFCCLVLNKWFVSAVITFVILGVLAFFIPNFQDIKYQPL
                    ************************************************************

    COL             LGYAAFLAIMSLLISFLLWYFTRNWRKERKARKLEKQIEKYGYEGAELRRKDKK
    N315            LGYAAFLAIMSLLISFLLWYFTRNWRKERKARKLEKQIEKYGYEGAELRRKDKK
    NCTC8325        LGYAAFLAIMSLLISFLLWYFTRNWRKERKARKLEKQIEKYGYEGAELRRKDKK
    Newman          LGYAAFLAIMSLLISFLLWYFTRNWRKERKARKLEKQIEKYGYEGAELRRKDKK
    USA300_FPR3757  LGYAAFLAIMSLLISFLLWYFTRNWRKERKARKLEKQIEKYGYEGAELRRKDKK
                    ******************************************************