Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003811000
  • symbol?: dapL
  • description?: hippurate hydrolase

      descriptions from strain specific annotations:

    • hippurate hydrolase
    • amidohydrolase
    • N-acetyl-L,L-diaminopimelate deacetylase
    • amidohydrolase family protein
    • M20/M25/M40 family peptidase
    • M20D subfamily hippurate hydrolase
    • putative peptidase
    • putative zinc peptidase
    • N-acetyldiaminopimelate deacetylase
  • strand?: +
  • coordinates?: 4101927..4103087
  • synteny block?: BlockID0028680
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1309 (hipO)
    USA300_FPR3757:
    04-02981:
    SA2981_1352
    08BA02176:
    C248_1437
    11819-97:
    MS7_1354
    71193:
    ST398NM01_1399
    ECT-R 2:
    ECTR2_1255
    ED133:
    SAOV_1407
    ED98:
    SAAV_1381
    HO 5096 0412:
    SAEMRSA15_12610
    JH1:
    SaurJH1_1488
    JH9:
    SaurJH9_1459
    JKD6008:
    SAA6008_01362
    JKD6159:
    SAA6159_01264
    LGA251:
    SARLGA251_13140
    M013:
    M013TW_1342
    MRSA252:
    SAR1410
    MSHR1132:
    SAMSHR1132_12390
    MSSA476:
    SAS1339
    Mu3:
    SAHV_1386
    Mu50:
    SAV1398
    MW2:
    MW1286
    RF122:
    SAB1253
    ST398:
    SAPIG1399
    T0131:
    SAT0131_01473
    TCH60:
    HMPREF0772_11811
    TW20:
    SATW20_13970
    USA300_TCH1516:
    USA300HOU_1333
    VC40:
    SAVC_06235

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNELEFVTKHRRHLHQHPELSLHEFETTAYIKAFLDSLNIKYDCPLETGVIAYLEGNGSH
    N315            MNELEFVTKHRRHLHQHPELSLHEFETTAYIKAFLDSLNIKYDCPLETGVIAYLEGNGSH
    NCTC8325        MNELEFVTKHRRHLHQHPELSLHEFETTAYIKAFLDSLNIKYDCPLETGVIAYLEGNGSH
    Newman          MNELEFVTKHRRHLHQHPELSLHEFETTAYIKAFLDSLNIKYDCPLETGVIAYLEGNGSH
    USA300_FPR3757  MNELEFVTKHRRHLHQHPELSLHEFETTAYIKAFLDSLNIKYDCPLETGVIAYLEGNGSH
                    ************************************************************

    COL             TIAYRADIDALPILEENDVPYRSQSDHVMHACGHDGHTTALMLFVQRCKDMQDAGQLPQN
    N315            TIAYRADIDALPILEENDVPYRSQSDHVMHACGHDGHTTALMLFVQRCKDMQDAGQLPQN
    NCTC8325        TIAYRADIDALPILEENDVPYRSQSDHVMHACGHDGHTTALMLFVQRCKDMQDAGQLPQN
    Newman          TIAYRADIDALPILEENDVPYRSQSDHVMHACGHDGHTTALMLFVQRCKDMQDAGQLPQN
    USA300_FPR3757  TIAYRADIDALPILEENDVPYRSQSDHVMHACGHDGHTTALMLFVQRCKDMQDAGQLPQN
                    ************************************************************

    COL             VVFIFQPAEETGGGANRLIKAGAFDKYPIEAVFGIHVNPFADEGIAVIRDEEITASATEY
    N315            VVFIFQPAEETGGGANRLIKAGAFDKYPIEAVFGIHVNPFADEGIAVIRDEEITASATEY
    NCTC8325        VVFIFQPAEETGGGANRLIKAGAFDKYPIEAVFGIHVNPFADEGIAVIRDEEITASATEY
    Newman          VVFIFQPAEETGGGANRLIKAGAFDKYPIEAVFGIHVNPFADEGIAVIRDEEITASATEY
    USA300_FPR3757  VVFIFQPAEETGGGANRLIKAGAFDKYPIEAVFGIHVNPFADEGIAVIRDEEITASATEY
                    ************************************************************

    COL             RFFLTGLSSHVADKEQGHSCGEALQHVLTQISQIQQFHLNGLKRNIVHIGHFKAGEAINT
    N315            RFFLTGLSSHVADKEQAHSCGEALQHVLTQISQIQQFHLNGLKRNIVHIGHFKAGEAINT
    NCTC8325        RFFLTGLSSHVADKEQGHSCGEALQHVLTQISQIQQFHLNGLKRNIVHIGHFKAGEAINT
    Newman          RFFLTGLSSHVADKEQGHSCGEALQHVLTQISQIQQFHLNGLKRNIVHIGHFKAGEAINT
    USA300_FPR3757  RFFLTGLSSHVADKEQGHSCGEALQHVLTQISQIQQFHLNGLKRNIVHIGHFKAGEAINT
                    ****************.*******************************************

    COL             VPSNGYLEGTIRTYDIDDLTIVKNQMHKIAESVKLLFNVDCEVKFAEGYPPTINSPKLRT
    N315            VPSNGYLEGTIRTYDIDDLTIVKNQMHKIAESVKLLFNVECEVKFAEGYPPTINSPKLRT
    NCTC8325        VPSNGYLEGTIRTYDIDDLTIVKNQMHKIAESVKLLFNVDCEVKFAEGYPPTINSPKLRT
    Newman          VPSNGYLEGTIRTYDIDDLTIVKNQMHKIAESVKLLFNVDCEVKFAEGYPPTINSPKLRT
    USA300_FPR3757  VPSNGYLEGTIRTYDIDDLTIVKNQMHKIAESVKLLFNVDCEVKFAEGYPPTINSPKLRT
                    ***************************************:********************

    COL             QIEDALIKADLNVYDKPTPFLFGEDFSFYGQQLAPAYFVFIGTRNEDKGFVTGLHTSHLN
    N315            QIEDALIKADLNVYDKPTPFLFGEDFSFYGQQLAPAYFVFIGTRNEDKGFVTGLHTSHLN
    NCTC8325        QIEDALIKADLNVYDKPTPFLFGEDFSFYGQQLAPAYFVFIGTRNEDKGFVTGLHTSHLN
    Newman          QIEDALIKADLNVYDKPTPFLFGEDFSFYGQQLAPAYFVFIGTRNEDKGFVTGLHTSHLN
    USA300_FPR3757  QIEDALIKADLNVYDKPTPFLFGEDFSFYGQQLAPAYFVFIGTRNEDKGFVTGLHTSHLN
                    ************************************************************

    COL             FDEKVLINVINFYENLLNNYKEV
    N315            FDEKALINVVNFYENLLNNYKEV
    NCTC8325        FDEKVLINVVNFYENLLNNYKEV
    Newman          FDEKVLINVVNFYENLLNNYKEV
    USA300_FPR3757  FDEKVLINVVNFYENLLNNYKEV
                    ****.****:*************