From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003820000
  • symbol?: acyP
  • description?: acylphosphatase

      descriptions from strain specific annotations:

    • acylphosphatase
    • putative acylphosphatase
    • Acylphosphate phosphohydrolase, putative
    • acylphosphatase (Acylphosphate phosphohydrolase)
    • acylphosphatase family protein
  • strand?: +
  • coordinates?: 4109431..4109709
  • synteny block?: BlockID0028770
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1358
    08BA02176:
    C248_1444
    11819-97:
    MS7_1360
    71193:
    ST398NM01_1406
    ECT-R 2:
    ECTR2_1261
    ED133:
    SAOV_1414
    ED98:
    SAAV_1388
    HO 5096 0412:
    SAEMRSA15_12670
    JH1:
    SaurJH1_1494
    JH9:
    SaurJH9_1465
    JKD6008:
    SAA6008_01368
    JKD6159:
    SAA6159_01271
    LGA251:
    SARLGA251_13210
    M013:
    M013TW_1349
    MRSA252:
    SAR1416
    MSHR1132:
    SAMSHR1132_12450
    MSSA476:
    SAS1345
    Mu3:
    SAHV_1392
    Mu50:
    SAV1404
    MW2:
    MW1292
    RF122:
    SAB1260
    ST398:
    SAPIG1406
    T0131:
    SAT0131_01479
    TCH60:
    HMPREF0772_11805 (acyP)
    TW20:
    SATW20_14030
    USA300_TCH1516:
    VC40:
    SAVC_06265

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---MRHIHLQVFGRVQGVGFRYFTQRIAMNYNIVGTVQNVDDYVEIYAQGDDADIERFIQ
    N315            ---MRHIHLQVFGRVQGVGFRYFTQRIAMNYNIVGTVQNVDDYVEIYAQGDDADIERFIQ
    NCTC8325        ---MRHIHLQVFGRVQGVGFRYFTQRIAMNYNIVGTVQNVDDYVEIYAQGDDADIERFIQ
    Newman          MVKMRHIHLQVFGRVQGVGFRYFTQRIAMNYNIVGTVQNVDDYVEIYAQGDDADIERFIQ
    USA300_FPR3757  ---MRHIHLQVFGRVQGVGFRYFTQRIAMNYNIVGTVQNVDDYVEIYAQGDDADIERFIQ
                       *********************************************************

    COL             GVIEGASPASNVTSHQLEELELNQKLSDFRSI
    N315            GVIEGASPASNVTSHQLEELELNQKLSDFRSI
    NCTC8325        GVIEGASPASNVTSHQLEELELNQKLSDFRSI
    Newman          GVIEGASPASNVTSHQLEELELNQKLSDFRSI
    USA300_FPR3757  GVIEGASPASNVTSHQLEELELNQKLSDFRSI
                    ********************************