From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003821000
  • symbol?:
  • description?: 5-bromo-4-chloroindolyl phosphate hydrolysis protein

      descriptions from strain specific annotations:

    • 5-bromo-4-chloroindolyl phosphate hydrolysis protein
    • 5-bromo-4-chloroindolyl phosphate hydrolase
    • 5-bromo-4-chloroindolyl phosphate hydrolysis family protein
    • 5-bromo-4-chloroindolyl phosphate hydrolysis protein-like protein
    • 5-bromo-4-chloroindolyl phosphate hydrolysis protein XpaC
    • membrane protein
    • Xpac
  • strand?: +
  • coordinates?: 4109728..4110360
  • synteny block?: BlockID0028780
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1359 (xpaC)
    08BA02176:
    11819-97:
    MS7_1361
    71193:
    ST398NM01_1407
    ECT-R 2:
    ECTR2_1262
    ED133:
    SAOV_1415
    ED98:
    SAAV_1389
    HO 5096 0412:
    SAEMRSA15_12680
    JH1:
    SaurJH1_1495
    JH9:
    SaurJH9_1466
    JKD6008:
    SAA6008_01369 (xpaC)
    JKD6159:
    SAA6159_01272 (xpaC)
    LGA251:
    SARLGA251_13220
    M013:
    M013TW_1350
    MRSA252:
    SAR1417
    MSHR1132:
    SAMSHR1132_12460
    MSSA476:
    SAS1346
    Mu3:
    SAHV_1393
    Mu50:
    SAV1405
    MW2:
    MW1293
    RF122:
    SAB1261
    ST398:
    SAPIG1407
    T0131:
    SAT0131_01480
    TCH60:
    HMPREF0772_11804
    TW20:
    SATW20_14040
    USA300_TCH1516:
    USA300HOU_1338 (xpaC)
    VC40:
    SAVC_06270

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTVRYNISHIFGVLVGIPVAFLTSIFGMIALDVSFLIDMSIGIVGFLMTYLPIQKLTSRK
    N315            --MRYNISHIFGVLVGIPVAFLTSIFGMIALDVSFLIDMSIGIVGFLMTYLPIQKLTSRK
    NCTC8325        MTVRYNISHIFGVLVGIPVAFLTSIFGMIALDVSFLIDMSIGIVGFLMTYLPIQKLTSRK
    Newman          MTVRYNISHIFGVLVGIPVAFLTSIFGMIALDVSFLIDMSIGIVGFLMTYLPIQKLTSRK
    USA300_FPR3757  MTVRYNISHIFGVLVGIPVAFLTSIFGMIALDVSFLIDMSIGIVGFLMTYLPIQKLTSRK
                      :*********************************************************

    COL             YLNEIGLTRKDYRYIRNQLNHTHQKLRGILKTYVNIRSIKDFRQINDIYQISRSIYTTVR
    N315            YLNEIGLTRKDYRYIRNQLNHTHQKLRGILKTYVNIRSIKDFRQINDIYQISRSIYTTVR
    NCTC8325        YLNEIGLTRKDYRYIRNQLNHTHQKLRGILKTYVNIRSIKDFRQINDIYQISRSIYTTVR
    Newman          YLNEIGLTRKDYRYIRNQLNHTHQKLRGILKTYVNIRSIKDFRQINDIYQISRSIYTTVR
    USA300_FPR3757  YLNEIGLTRKDYRYIRNQLNHTHQKLRGILKTYVNIRSIKDFRQINDIYQISRSIYTTVR
                    ************************************************************

    COL             QRPASFYKVEGFFYSHIDNALNLVDAYTRLAKMPKKSINEQQKLEQTRITLDEVKRTLIA
    N315            QRPASFYKVEGFFYSHIDNALNLVDAYTRLAKMPKKSINEQQKLEQTRITLDEVKRTLIA
    NCTC8325        QRPASFYKVEGFFYSHIDNALNLVDAYTRLAKMPKKSINEQQKLEQTRITLDEVKRTLIA
    Newman          QRPASFYKVEGFFYSHIDNALNLVDAYTRLAKMPKKSINEQQKLEQTRITLDEVKRTLIA
    USA300_FPR3757  QRPASFYKVEGFFYSHIDNALNLVDAYTRLAKMPKKSINEQQKLEQTRITLDEVKRTLIA
                    ************************************************************

    COL             DLKRLNEDDYERLDIEMELNKLHQKHHQD
    N315            DLKRLNEDDYERLDIEMELNKLHQKHHQD
    NCTC8325        DLKRLNEDDYERLDIEMELNKLHQKHHQD
    Newman          DLKRLNEDDYERLDIEMELNKLHQKHHQD
    USA300_FPR3757  DLKRLNEDDYERLDIEMELNKLHQKHHQD
                    *****************************