From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003825000
  • symbol?: brnQ3
  • description?: branched-chain amino acid carrier protein

      descriptions from strain specific annotations:

    • branched-chain amino acid carrier protein
    • branched-chain amino acid transport system II carrier protein
    • Branched-chain amino acid transport system carrier protein
    • branched-chain amino acid transporter protein
    • LIVCS family branched chain amino acid:cation symporter
    • putative branched-chain amino acid transporterprotein
    • branched-chain amino acid permease, BrnQ_1
    • Putative branched-chain amino acid carrier protein
    • branched-chain amino acid carrier II protein
  • strand?: -
  • coordinates?: 4112572..4113951
  • synteny block?: BlockID0028820
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1443 (brnQ3)
    N315:
    SA1239 (braB)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1361 (braB)
    08BA02176:
    C248_1446
    11819-97:
    MS7_1363
    71193:
    ST398NM01_1409
    ECT-R 2:
    ECTR2_1264 (brnQ)
    ED133:
    SAOV_1417c
    ED98:
    SAAV_1391 (brnQ3)
    HO 5096 0412:
    SAEMRSA15_12700
    JH1:
    SaurJH1_1497
    JH9:
    SaurJH9_1468
    JKD6008:
    SAA6008_01373 (brnQ_1)
    JKD6159:
    SAA6159_01274 (brnQ_1)
    LGA251:
    SARLGA251_13240
    M013:
    M013TW_1352
    MRSA252:
    SAR1419
    MSHR1132:
    SAMSHR1132_12480
    MSSA476:
    SAS1350
    Mu3:
    SAHV_1395 (braB)
    Mu50:
    SAV1407 (braB)
    MW2:
    MW1297 (braB)
    RF122:
    SAB1263c
    ST398:
    SAPIG1409 (brnQ)
    T0131:
    SAT0131_01485
    TCH60:
    HMPREF0772_11802 (brnQ3)
    TW20:
    SATW20_14080
    USA300_TCH1516:
    USA300HOU_1342 (brnQ2)
    VC40:
    SAVC_06285

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKNTWVIGFTLFAMFFGAGNLIFPPNLGLDSGQFFWPAILAFVLTGIGLPLLGVIVGAL
    N315            MNKNTWVIGFTLFAMFFGAGNLIFPPNLGLDSGQFFWPAILAFVLTGIGLPLLGVIVGAL
    NCTC8325        MNKNTWVIGFTLFAMFFGAGNLIFPPNLGLDSGQFFWPAILAFVLTGIGLPLLGVIVGAL
    Newman          MNKNTWVIGFTLFAMFFGAGNLIFPPNLGLDSGQFFWPAILAFVLTGIGLPLLGVIVGAL
    USA300_FPR3757  MNKNTWVIGFTLFAMFFGAGNLIFPPNLGLDSGQFFWPAILAFVLTGIGLPLLGVIVGAL
                    ************************************************************

    COL             DKEGYIGALNKISPKFSILFLIIIYLTIGPLFAIPRTASTSFEMTITPIIHSNSSIALFI
    N315            DKEGYIGALNKISPKFSILFLIIIYLTIGPLFAIPRTASTSFEMTITPIIHSNSSIALFI
    NCTC8325        DKEGYIGALNKISPKFSILFLIIIYLTIGPLFAIPRTASTSFEMTITPIIHSNSSIALFI
    Newman          DKEGYIGALNKISPKFSILFLIIIYLTIGPLFAIPRTASTSFEMTITPIIHSNSSIALFI
    USA300_FPR3757  DKEGYIGALNKISPKFSILFLIIIYLTIGPLFAIPRTASTSFEMTITPIIHSNSSIALFI
                    ************************************************************

    COL             FTIIYFIVVLYICLNPSKLIDRIGSLLTPLLLITILAMIIKGYLDFSGNSAGKGNEALYH
    N315            FTIIYFIVVLYICLNPSKLIDRIGSLLTPLLLITILAMIIKGYLDFSGNSAGKGNEALYH
    NCTC8325        FTIIYFIVVLYICLNPSKLIDRIGSLLTPLLLITILAMIIKGYLDFSGNSAGKGNEALYH
    Newman          FTIIYFIVVLYICLNPSKLIDRIGSLLTPLLLITILAMIIKGYLDFSGNSAGKGNEALYH
    USA300_FPR3757  FTIIYFIVVLYICLNPSKLIDRIGSLLTPLLLITILAMIIKGYLDFSGNSAGKGNEALYH
                    ************************************************************

    COL             SNFSSFAEGFTQGYLTMDAIAAIAFSMIVVNAVKLTGITKTNQIFKQTLTAGLIAAVALI
    N315            SNFSSFAEGFTQGYLTMDAIAAIAFSMIVVNAVKLTGITKTNQIFKQTLTAGLIAAVALI
    NCTC8325        SNFSSFAEGFTQGYLTMDAIAAIAFSMIVVNAVKLTGITKTNQIFKQTLTAGLIAAVALI
    Newman          SNFSSFAEGFTQGYLTMDAIAAIAFSMIVVNAVKLTGITKTNQIFKQTLTAGLIAAVALI
    USA300_FPR3757  SNFSSFAEGFTQGYLTMDAIAAIAFSMIVVNAVKLTGITKTNQIFKQTLTAGLIAAVALI
                    ************************************************************

    COL             FIYISLGYIGNHMPVSDMTLDQLKSKDRNIGTYLLTTMASTGFGSFGKYLLGIIVALACL
    N315            FIYISLGYIGNHMPVSDMTLDQLKSKDRNIGTYLLTTMASTGFGSFGKYLLGIIVALACL
    NCTC8325        FIYISLGYIGNHMPVSDMTLDQLKSKDRNIGTYLLTTMASTGFGSFGKYLLGIIVALACL
    Newman          FIYISLGYIGNHMPVSDMTLDQLKSKDRNIGTYLLTTMASTGFGSFGKYLLGIIVALACL
    USA300_FPR3757  FIYISLGYIGNHMPVSDMTLDQLKSKDRNIGTYLLTTMASTGFGSFGKYLLGIIVALACL
                    ************************************************************

    COL             TTACGLIVAVSEYFHRIVPKVSYKAFVLVFILMSFIIANQGLNAVISMSIPVLSIVYPVA
    N315            TTACGLIVAVSEYFHRIVPKVSYKAFVLVFILMSFIIANQGLNAVISMSIPVLSIVYPVA
    NCTC8325        TTACGLIVAVSEYFHRIVPKVSYKAFVLVFILMSFIIANQGLNAVISMSIPVLSIVYPVA
    Newman          TTACGLIVAVSEYFHRIVPKVSYKAFVLVFILMSFIIANQGLNAVISMSIPVLSIVYPVA
    USA300_FPR3757  TTACGLIVAVSEYFHRIVPKVSYKAFVLVFILMSFIIANQGLNAVISMSIPVLSIVYPVA
                    ************************************************************

    COL             ITVVLLILIAKFIPTKRISQQIPVIIVFILSIFSVISKLGWLKINFIESLPLRAYSLEWF
    N315            ITVVLLILIAKFIPTKRISQQIPVIIVFILSIFSVISKLGWLKINFIESLPLRAYSLEWF
    NCTC8325        ITVVLLILIAKFIPTKRISQQIPVIIVFILSIFSVISKLGWLKINFIESLPLRAYSLEWF
    Newman          ITVVLLILIAKFIPTKRISQQIPVIIVFILSIFSVISKLGWLKINFIESLPLRAYSLEWF
    USA300_FPR3757  ITVVLLILIAKFIPTKRISQQIPVIIVFILSIFSVISKLGWLKINFIESLPLRAYSLEWF
                    ************************************************************

    COL             PVAIIATILGYLVGIFVKQDPIKYQQE
    N315            PVAIIATILGYLVGIFVKQDPIKYQQE
    NCTC8325        PVAIIATILGYLVGIFVKQDPIKYQQE
    Newman          PVAIIATILGYLVGIFVKQDPIKYQQE
    USA300_FPR3757  PVAIIATILGYLVGIFVKQDPIKYQQE
                    ***************************