From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003826000
  • symbol?:
  • description?: nitric oxide reductase activation protein NorD

      descriptions from strain specific annotations:

    • nitric oxide reductase activation protein NorD
    • cobalamin biosynthesis CobT VWA domain protein
    • von Willebrand factor, type A
    • von Willebrand factor type A
    • von Willebrand factor type A domain-containing protein
  • strand?: -
  • coordinates?: 4114636..4116522
  • synteny block?: BlockID0028830
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1362 (norD)
    08BA02176:
    C248_1447
    11819-97:
    MS7_1364
    71193:
    ST398NM01_1410
    ECT-R 2:
    ECTR2_1265
    ED133:
    SAOV_1418c
    ED98:
    SAAV_1392
    HO 5096 0412:
    SAEMRSA15_12710
    JH1:
    SaurJH1_1498
    JH9:
    SaurJH9_1469
    JKD6008:
    SAA6008_01374 (norD)
    JKD6159:
    SAA6159_01275 (norD)
    LGA251:
    SARLGA251_13250
    M013:
    M013TW_1353
    MRSA252:
    SAR1420
    MSHR1132:
    SAMSHR1132_12490
    MSSA476:
    SAS1351
    Mu3:
    SAHV_1396
    Mu50:
    SAV1408
    MW2:
    MW1298
    RF122:
    SAB1264c
    ST398:
    SAPIG1410
    T0131:
    SAT0131_01486
    TCH60:
    HMPREF0772_11801
    TW20:
    SATW20_14090
    USA300_TCH1516:
    USA300HOU_1343
    VC40:
    SAVC_06290

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSDRFIKFNDEQLDAKQVMMLQDLARLLLKNEQTQVKIQKFPYYNPVQNVLITSWFWSHR
    N315            MSDRFIKFNDEQLDAKQVMMLQDLARLLLKNEQTQVKIQKFPYYNPVQNVLITSWFWSHR
    NCTC8325        MSDRFIKFNDEQLDAKQVMMLQDLARLLLKNEQTQVKIQKFPYYNPVQNVLITSWFWSHR
    Newman          MSDRFIKFNDEQLDAKQVMMLQDLARLLLKNEQTQVKIQKFPYYNPVQNVLITSWFWSHR
    USA300_FPR3757  MSDRFIKFNDEQLDAKQVMMLQDLARLLLKNEQTQVKIQKFPYYNPVQNVLITSWFWSHR
                    ************************************************************

    COL             PSHIEMAGLKTDVMLAAYGYHMMDVQIVNEVVQDKTFKHPKFYQQLFKLLEDMRVLNSIK
    N315            PSHIEMAGLKTDVMLAAYGYHMMDVQIVNEVVQDKTFKHPKFYQQLFKLLEDMRVLNSIK
    NCTC8325        PSHIEMAGLKTDVMLAAYGYHMMDVQIVNEVVQDKTFKHPKFYQQLFKLLEDMRVLNSIK
    Newman          PSHIEMAGLKTDVMLAAYGYHMMDVQIVNEVVQDKTFKHPKFYQQLFKLLEDMRVLNSIK
    USA300_FPR3757  PSHIEMAGLKTDVMLAAYGYHMMDVQIVNEVVQDKTFKHPKFYQQLFKLLEDMRVLNSIK
                    ************************************************************

    COL             VERPSTAKLIDLRLDTRISYTESQIKVYRTKTQYTDLLFLYLEHAFLSQDFFDIPSIHSD
    N315            VERPSTAKLIDLRLDTRVSYTESQIKVYRTKTQYTDLLFLYLEHAFLSQDFFDIPSIHSD
    NCTC8325        VERPSTAKLIDLRLDTRISYTESQIKVYRTKTQYTDLLFLYLEHAFLSQDFFDIPSIHSD
    Newman          VERPSTAKLIDLRLDTRISYTESQIKVYRTKTQYTDLLFLYLEHAFLSQDFFDIPSIHSD
    USA300_FPR3757  VERPSTAKLIDLRLDTRISYTESQIKVYRTKTQYTDLLFLYLEHAFLSQDFFDIPSIHSD
                    *****************:******************************************

    COL             LDDILVNMFLYLPNFFQNQNSEDNMYLAQRIMYQVDDILKEDMLNEYYYLPKTLYNTLAS
    N315            LDDILVNMFLYLPNFFQNQNSEDNMYLAQRIMYQVDDILKEDMLNEYYYLPKTLYNTLAS
    NCTC8325        LDDILVNMFLYLPNFFQNQNSEDNMYLAQRIMYQVDDILKEDMLNEYYYLPKTLYNTLAS
    Newman          LDDILVNMFLYLPNFFQNQNSEDNMYLAQRIMYQVDDILKEDMLNEYYYLPKTLYNTLAS
    USA300_FPR3757  LDDILVNMFLYLPNFFQNQNSEDNMYLAQRIMYQVDDILKEDMLNEYYYLPKTLYNTLAS
                    ************************************************************

    COL             PEFDDLKRTDASQVDGQDDTSEDDDNESEKADSKSADSESKGGAYLEMELHEGQNSETLG
    N315            PEFDDLKRTDASQVDGQDDTSEDDDNESEKADSKSADSESKGGAYLEMELHEGQNSETLG
    NCTC8325        PEFDDLKRTDASQVDGQDDTSEDDDNESEKADSKSADSESKGGAYLEMELHEGQNSETLG
    Newman          PEFDDLKRTDASQVDGQDDTSEDDDNESEKADSKSADSESKGGAYLEMELHEGQNSETLG
    USA300_FPR3757  PEFDDLKRTDASQVDGQDDTSEDDDNESEKADSKSADSESKGGAYLEMELHEGQNSETLG
                    ************************************************************

    COL             NDEAREGDATDDMTDMMTKKGKGSNDTLNREEGDAVGQSQAFQLDGVNKNVEIKWQIPEI
    N315            NDEAREGDATDDMTDMMTKKGKGSNDTLNREEGDAVGQSQAFQLDGVNKNVEIKWQIPEI
    NCTC8325        NDEAREGDATDDMTDMMTKKGKGSNDTLNREEGDAVGQSQAFQLDGVNKNVEIKWQIPEI
    Newman          NDEAREGDATDDMTDMMTKKGKGSNDTLNREEGDAVGQSQAFQLDGVNKNVEIKWQIPEI
    USA300_FPR3757  NDEAREGDATDDMTDMMTKKGKGSNDTLNREEGDAVGQSQAFQLDGVNKNVEIKWQIPEI
                    ************************************************************

    COL             EPQYVLEYQESKQDVQYEIKDLIQIIKKTIEREQRDARFNLTKGRLQKDLINWFIDDQYK
    N315            EPQYVLEYQESKQDVQYEIKDLIQIIKKTIEREQRDARFNLTKGRLQKDLINWFIDDQYK
    NCTC8325        EPQYVLEYQESKQDVQYEIKDLIQIIKKTIEREQRDARFNLTKGRLQKDLINWFIDDQYK
    Newman          EPQYVLEYQESKQDVQYEIKDLIQIIKKTIEREQRDARFNLTKGRLQKDLINWFIDDQYK
    USA300_FPR3757  EPQYVLEYQESKQDVQYEIKDLIQIIKKTIEREQRDARFNLTKGRLQKDLINWFIDDQYK
                    ************************************************************

    COL             LFYKKQDLSKSFDATFTLLIDASASMHDKMAETKKGVVLFHETLKALNIKHEILSFSEDA
    N315            LFYKKQDLSKSFDATFTLLIDASASMHDKMAETKKGVVLFHETLKALNIKHEILSFSEDA
    NCTC8325        LFYKKQDLSKSFDATFTLLIDASASMHDKMAETKKGVVLFHETLKALNIKHEILSFSEDA
    Newman          LFYKKQDLSKSFDATFTLLIDASASMHDKMAETKKGVVLFHETLKALNIKHEILSFSEDA
    USA300_FPR3757  LFYKKQDLSKSFDATFTLLIDASASMHDKMAETKKGVVLFHETLKALNIKHEILSFSEDA
                    ************************************************************

    COL             FDSDEHAQPNIINEIINYDYSTFEKDGPRIMALEPQDDNRDGVAIRVASERLMRRNQHQR
    N315            FDSDDHAQPNIINEIINYDYSTFEKDGPRIMALEPQDDNRDGVAIRVASERLMRRNQHQR
    NCTC8325        FDSDEHAQPNIINEIINYDYSTFEKDGPRIMALEPQDDNRDGVAIRVASERLMRRNQHQR
    Newman          FDSDEHAQPNIINEIINYDYSTFEKDGPRIMALEPQDDNRDGVAIRVASERLMRRNQHQR
    USA300_FPR3757  FDSDEHAQPNIINEIINYDYSTFEKDGPRIMALEPQDDNRDGVAIRVASERLMRRNQHQR
                    ****:*******************************************************

    COL             FLIVFSDGEPSAFNYSQDGIIDTYEAVEMSRKFGIEVFNVFLSQDPITEDVEQTIHNIYG
    N315            FLIVFSDGEPSAFNYSQDGIIDTYEAVEMSRKFGIEVFNVFLSQDPITEDVEQTIHNIYG
    NCTC8325        FLIVFSDGEPSAFNYSQDGIIDTYEAVEMSRKFGIEVFNVFLSQDPITEDVEQTIHNIYG
    Newman          FLIVFSDGEPSAFNYSQDGIIDTYEAVEMSRKFGIEVFNVFLSQDPITEDVEQTIHNIYG
    USA300_FPR3757  FLIVFSDGEPSAFNYSQDGIIDTYEAVEMSRKFGIEVFNVFLSQDPITEDVEQTIHNIYG
                    ************************************************************

    COL             QYAIFVEGVAHLPGHLSPLLKKLLLKSL
    N315            QYAIFVEGVAHLPGHLSPLLKKLLLKSL
    NCTC8325        QYAIFVEGVAHLPGHLSPLLKKLLLKSL
    Newman          QYAIFVEGVAHLPGHLSPLLKKLLLKSL
    USA300_FPR3757  QYAIFVEGVAHLPGHLSPLLKKLLLKSL
                    ****************************