From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003829000
  • symbol?:
  • description?: glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein

      descriptions from strain specific annotations:

    • glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein
    • Glyoxalase/bleomycin resistance protein/dioxygenase
    • Lactoylglutathione lyase
    • ABC transporter
  • strand?: -
  • coordinates?: 4117741..4118550
  • synteny block?: BlockID0028860
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1365
    08BA02176:
    C248_1450
    11819-97:
    MS7_1367
    71193:
    ST398NM01_1413
    ECT-R 2:
    ECTR2_1268
    ED133:
    SAOV_1421c
    ED98:
    SAAV_1395
    HO 5096 0412:
    SAEMRSA15_12740
    JH1:
    SaurJH1_1501
    JH9:
    SaurJH9_1472
    JKD6008:
    SAA6008_01377
    JKD6159:
    SAA6159_01278
    LGA251:
    SARLGA251_13280
    M013:
    M013TW_1356
    MRSA252:
    SAR1423
    MSHR1132:
    SAMSHR1132_12520
    MSSA476:
    SAS1354
    Mu3:
    SAHV_1399
    Mu50:
    SAV1411
    MW2:
    MW1301
    RF122:
    SAB1267c
    ST398:
    SAPIG1413
    T0131:
    SAT0131_01489
    TCH60:
    HMPREF0772_11798
    TW20:
    SATW20_14120
    USA300_TCH1516:
    USA300HOU_1346
    VC40:
    SAVC_06305

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MCGLRSITLGTTNIEQTKHFMVDILGLNYEELLENSIRFGDADISPGTRLQFIQVPSEQL
    N315            MCGLRSITLGTTNIEQTKHFMVDILGLNYEELLENSIRFGDADISPGTRLQFIQVPSEQL
    NCTC8325        MCGLRSITLGTTNIEQTKHFMVDILGLNYEELLENSIRFGDADISPGTRLQFIQVPSEQL
    Newman          MCGLRSITLGTTNIEQTKHFMVDILGLNYEELLENSIRFGDADISPGTRLQFIQVPSEQL
    USA300_FPR3757  MCGLRSITLGTTNIEQTKHFMVDILGLNYEELLENSIRFGDADISPGTRLQFIQVPSEQL
                    ************************************************************

    COL             EESHFVGIGLRTPTDSGLEEYAEILSNKDIPFTTVKELNGNKYFSLEDNNGHIFSIYSNE
    N315            EESHFVGIGLRTPTDSGLEEYAEILSNKDIPFTTVKELNGNKYFSLEDNNGHIFSIYSNE
    NCTC8325        EESHFVGIGLRTPTDSGLEEYAEILSNKDIPFTTVKELNGNKYFSLEDNNGHIFSIYSNE
    Newman          EESHFVGIGLRTPTDSGLEEYAEILSNKDIPFTTVKELNGNKYFSLEDNNGHIFSIYSNE
    USA300_FPR3757  EESHFVGIGLRTPTDSGLEEYAEILSNKDIPFTTVKELNGNKYFSLEDNNGHIFSIYSNE
                    ************************************************************

    COL             NNYGVGLGMPSFESAVNPLHQVQGLGPVILKVNHVDITGQILTNIFGLEVFAEYQPFDNA
    N315            NNYGVGLGMPSFESAVNPLHQVQGLGPVILKVNHVDITGQILTNIFGLEVFAEYQPFDNA
    NCTC8325        NNYGVGLGMPSFESAVNPLHQVQGLGPVILKVNHVDITGQILTNIFGLEVFAEYQPFDNA
    Newman          NNYGVGLGMPSFESAVNPLHQVQGLGPVILKVNHVDITGQILTNIFGLEVFAEYQPFDNA
    USA300_FPR3757  NNYGVGLGMPSFESAVNPLHQVQGLGPVILKVNHVDITGQILTNIFGLEVFAEYQPFDNA
                    ************************************************************

    COL             DYHVQVFKVGTGGLGGEIHLMPVETEMTMPEYGAVDQVEFETKDADFFNQAKSRLDEVEI
    N315            DYHVQVFKVGTGGLGGEIHLMPVETEMTMPEYGAVDQVEFETKDADFFNQAKSRLDEVEI
    NCTC8325        DYHVQVFKVGTGGLGGEIHLMPVETEMTMPEYGAVDQVEFETKDADFFNQAKSRLDEVEI
    Newman          DYHVQVFKVGTGGLGGEIHLMPVETEMTMPEYGAVDQVEFETKDADFFNQAKSRLDEVEI
    USA300_FPR3757  DYHVQVFKVGTGGLGGEIHLMPVETEMTMPEYGAVDQVEFETKDADFFNQAKSRLDEVEI
                    ************************************************************

    COL             PYQTLEQDDIESIRITENSGLSFIFTLQK
    N315            PYQTLEQDDIESIRITENSGLSFIFTLQK
    NCTC8325        PYQTLEQDDIESIRITENSGLSFIFTLQK
    Newman          PYQTLEQDDIESIRITENSGLSFIFTLQK
    USA300_FPR3757  PYQTLEQDDIESIRITENSGLSFIFTLQK
                    *****************************