From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003833000
  • symbol?: arlS
  • description?: protein histidine kinase ArlS

      descriptions from strain specific annotations:

    • protein histidine kinase ArlS
    • integral membrane sensor signal transduction histidine kinase
    • ATPase
    • sensor histidine kinase ArlS
    • Two component system histidine kinase ArlS
    • HAMP domain protein
    • sensor kinase
    • putative protein histidine kinase ArlS
    • sensor histidine kinase protein
    • two-component sensor histidine kinase
    • signal transduction histidine-protein kinase ArlS
    • sensor kinase protein
  • strand?: -
  • coordinates?: 4123920..4124861
  • synteny block?: BlockID0028900
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1450 (arlS)
    N315:
    SA1246 (arlS)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1368 (arlS)
    08BA02176:
    C248_1453 (arlS)
    11819-97:
    MS7_1370 (arlS)
    71193:
    ST398NM01_1416
    ECT-R 2:
    ECTR2_1271
    ED133:
    SAOV_1424c
    ED98:
    SAAV_1398 (arlS)
    HO 5096 0412:
    SAEMRSA15_12770 (arlS)
    JH1:
    SaurJH1_1504
    JH9:
    SaurJH9_1475
    JKD6008:
    SAA6008_01380 (arlS)
    JKD6159:
    SAA6159_01281 (arlS)
    LGA251:
    SARLGA251_13310 (arlS)
    M013:
    M013TW_1359
    MRSA252:
    SAR1426 (arlS)
    MSHR1132:
    SAMSHR1132_12550
    MSSA476:
    SAS1357
    Mu3:
    SAHV_1402 (arlS)
    Mu50:
    SAV1414 (arlS)
    MW2:
    MW1304 (arlS)
    RF122:
    SAB1270c (arlS)
    ST398:
    SAPIG1416
    T0131:
    SAT0131_01492
    TCH60:
    HMPREF0772_11794 (arlS)
    TW20:
    SATW20_14150 (arlS)
    USA300_TCH1516:
    USA300HOU_1349
    VC40:
    SAVC_06320

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKRKLRNNWIIVTTMITFVTIFLFCLIIIFFLKDTLHNSELDDAERSSSDINNLFHSKP
    N315            MTKRKLRNNWIIVTTMITFVTIFLFCLIIIFFLKDTLHNSELDDAERSSSDINNLFHSKP
    NCTC8325        MTKRKLRNNWIIVTTMITFVTIFLFCLIIIFFLKDTLHNSELDDAERSSSDINNLFHSKP
    Newman          MTKRKLRNNWIIVTTMITFVTIFLFCLIIIFFLKDTLHNSELDDAERSSSDINNLFHSKP
    USA300_FPR3757  MTKRKLRNNWIIVTTMITFVTIFLFCLIIIFFLKDTLHNSELDDAERSSSDINNLFHSKP
                    ************************************************************

    COL             VKDISALDLNASLGNFQEIIIYDEHNNKLFETSNDNTVRVEPGYEHRYFDRVIKKRYKGI
    N315            VKDISALDLNASLGNFQEIIIYDEHNNKLFETSNDNTVRVEPGYEHRYFDRVIKKRYKGI
    NCTC8325        VKDISALDLNASLGNFQEIIIYDEHNNKLFETSNDNTVRVEPGYEHRYFDRVIKKRYKGI
    Newman          VKDISALDLNASLGNFQEIIIYDEHNNKLFETSNDNTVRVEPGYEHRYFDRVIKKRYKGI
    USA300_FPR3757  VKDISALDLNASLGNFQEIIIYDEHNNKLFETSNDNTVRVEPGYEHRYFDRVIKKRYKGI
                    ************************************************************

    COL             EYLIIKEPITTQDFKGYSLLIHSLENYDNIVKSLYIIALAFGVIATIITATISYVFSTQI
    N315            EYLIIKEPITTQDFKGYSLLIHSLENYDNIVKSLYIIALAFGVIATIITATISYVFSTQI
    NCTC8325        EYLIIKEPITTQDFKGYSLLIHSLENYDNIVKSLYIIALAFGVIATIITATISYVFSTQI
    Newman          EYLIIKEPITTQDFKGYSLLIHSLENYDNIVKSLYIIALAFGVIATIITATISYVFSTQI
    USA300_FPR3757  EYLIIKEPITTQDFKGYSLLIHSLENYDNIVKSLYIIALAFGVIATIITATISYVFSTQI
                    ************************************************************

    COL             TKPLVSLSNKMIEIRRDGFQNKLQLNTNYEEIDNLANTFNEMMSQIEESFNQQRQFVEDA
    N315            TKPLVSLSNKMIEIRRDGFQNKLQLNTNYEEIDNLANTFNEMMSQIEESFNQQRQFVEDA
    NCTC8325        TKPLVSLSNKMIEIRRDGFQNKLQLNTNYEEIDNLANTFNEMMSQIEESFNQQRQFVEDA
    Newman          TKPLVSLSNKMIEIRRDGFQNKLQLNTNYEEIDNLANTFNEMMSQIEESFNQQRQFVEDA
    USA300_FPR3757  TKPLVSLSNKMIEIRRDGFQNKLQLNTNYEEIDNLANTFNEMMSQIEESFNQQRQFVEDA
                    ************************************************************

    COL             SHELRTPLQIIQGHLNLIQRWGKKDPAVLEESLNISIEEMNRIIKLVEELLELTKGDVND
    N315            SHELRTPLQIIQGHLNLIQRWGKKDPAVLEESLNISIEEMNRIIKLVEELLELTKGDVND
    NCTC8325        SHELRTPLQIIQGHLNLIQRWGKKDPAVLEESLNISIEEMNRIIKLVEELLELTKGDVND
    Newman          SHELRTPLQIIQGHLNLIQRWGKKDPAVLEESLNISIEEMNRIIKLVEELLELTKGDVND
    USA300_FPR3757  SHELRTPLQIIQGHLNLIQRWGKKDPAVLEESLNISIEEMNRIIKLVEELLELTKGDVND
                    ************************************************************

    COL             ISSEAQTVHINDEIRSRIHSLKQLHPDYQFDTDLTSKNLEIKMKPHQFEQLFLIFIDNAI
    N315            ISSEAQTVHINDEIRSRIHSLKQLHPDYQFDTDLTSKNLEIKMKPHQFEQLFLIFIDNAI
    NCTC8325        ISSEAQTVHINDEIRSRIHSLKQLHPDYQFDTDLTSKNLEIKMKPHQFEQLFLIFIDNAI
    Newman          ISSEAQTVHINDEIRSRIHSLKQLHPDYQFDTDLTSKNLEIKMKPHQFEQLFLIFIDNAI
    USA300_FPR3757  ISSEAQTVHINDEIRSRIHSLKQLHPDYQFDTDLTSKNLEIKMKPHQFEQLFLIFIDNAI
                    ************************************************************

    COL             KYDVKNKKIKVKTRLKNKQKIIEITDHGIGIPEEDQDFIFDRFYRVDKSRSRSQGGNGLG
    N315            KYDVKNKKIKVKTRLKNKQKIIEITDHGIGIPEEDQDFIFDRFYRVDKSRSRSQGGNGLG
    NCTC8325        KYDVKNKKIKVKTRLKNKQKIIEITDHGIGIPEEDQDFIFDRFYRVDKSRSRSQGGNGLG
    Newman          KYDVKNKKIKVKTRLKNKQKIIEITDHGIGIPEEDQDFIFDRFYRVDKSRSRSQGGNGLG
    USA300_FPR3757  KYDVKNKKIKVKTRLKNKQKIIEITDHGIGIPEEDQDFIFDRFYRVDKSRSRSQGGNGLG
                    ************************************************************

    COL             LSIAQKIIQLNGGSIKIKSEINKGTTFKIIF
    N315            LSIAQKIIQLNGGSIKIKSEINKGTTFKIIF
    NCTC8325        LSIAQKIIQLNGGSIKIKSEINKGTTFKIIF
    Newman          LSIAQKIIQLNGGSIKIKSEINKGTTFKIIF
    USA300_FPR3757  LSIAQKIIQLNGGSIKIKSEINKGTTFKIIF
                    *******************************