From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003844000
  • symbol?:
  • description?: N-acetyltransferase

      descriptions from strain specific annotations:

    • N-acetyltransferase
    • acetyltransferase, GNAT family protein
    • acetyltransferase
    • Acetyltransferase (GNAT) family
    • acetyltransferase (GNAT) family protein
    • acetyltransferase, gnat family
    • GNAT family acetyltransferase
    • N-acetyltransferase GCN5
    • pseudogene
    • putative acetyltransferase
  • strand?: -
  • coordinates?: 4131164..4131674
  • synteny block?: BlockID0029010
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1373
    08BA02176:
    C248_1459
    11819-97:
    MS7_1374
    71193:
    ST398NM01_1420
    ECT-R 2:
    ECTR2_1275
    ED133:
    SAOV_1428c
    ED98:
    SAAV_1402
    HO 5096 0412:
    SAEMRSA15_12820
    JH1:
    SaurJH1_1508
    JH9:
    SaurJH9_1479
    JKD6008:
    SAA6008_01387
    JKD6159:
    SAA6159_01286
    LGA251:
    SARLGA251_13350
    M013:
    M013TW_1365
    MRSA252:
    SAR1431
    MSHR1132:
    SAMSHR1132_12590
    MSSA476:
    SAS1361
    Mu3:
    SAHV_1407
    Mu50:
    SAV1419
    MW2:
    MW1308
    RF122:
    SAB1274c
    ST398:
    SAPIG1420
    T0131:
    SAT0131_01499
    TCH60:
    HMPREF0772_11788
    TW20:
    SATW20_14200
    USA300_TCH1516:
    USA300HOU_1356
    VC40:
    SAVC_06345

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MIRLGKMSDLDQILNLVEEAKELMKEHDNEQWDDQYPLLEHFEEDIAKDYLYVLEENDKI
    NCTC8325        MIRLGKMSDLDQILNLVEEAKELMKEHDNEQWDDQYPLLEHFEEDIAKDYLYVLEENDKI
    Newman          MIRLGKMSDLDQILNLVEEAKELMKEHDNEQWDDQYPLLEHFEEDIAKDYLYVLEENDKI
    USA300_FPR3757  MIRLGKMSDLDQILNLVEEAKELMKEHDNEQWDDQYPLLEHFEEDIAKDYLYVLEENDKI
                    ************************************************************

    N315            YGFIVVDQDQAEWYDDIDWPVNREGAFVIHRLTGSKEYKGAATELFNYVIDVVKARGAEV
    NCTC8325        YGFIVVDQDQAEWYDDIDWPVNREGAFVIHRLTGSKEYKGAATELFNYVIDVVKARGAEV
    Newman          YGFIVVDQDQAEWYDDIDWPVNREGAFVIHRLTGSKEYKGAATELFNYVIDVVKARGAEV
    USA300_FPR3757  YGFIVVDQDQAEWYDDIDWPVNREGAFVIHRLTGSKEYKGAATELFNYVIDVVKARGAEV
                    ************************************************************

    N315            ILTDTFALNKPAQGLFAKFGFHKVGEQLMEYPPYDKGEPFYAYYKNLKE
    NCTC8325        ILTDTFALNKPAQGLFAKFGFHKVGEQLMEYPPYDKGEPFYAYYKNLKE
    Newman          ILTDTFALNKPAQGLFAKFGFHKVGEQLMEYPPYDKGEPFYAYYKNLKE
    USA300_FPR3757  ILTDTFALNKPAQGLFAKFGFHKVGEQLMEYPPYDKGEPFYAYYKNLKE
                    *************************************************