From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003849000
  • symbol?: ctpA
  • description?: serine protease

      descriptions from strain specific annotations:

    • serine protease
    • carboxyl-terminal protease
    • carboxy-terminal processing proteinase ctpA
    • carboxy-processing protease
    • carboxy-terminal processing protease
    • C-terminal processing peptidase family protein
    • ctpA-like serine protease
    • putative carboxy-terminal processing proteinasectpA
    • putative CtpA-like serine protease
    • putative protease
  • strand?: -
  • coordinates?: 4134288..4135783
  • synteny block?: BlockID0029050
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1253 (ctpA)
    NCTC8325:
    Newman:
    NWMN_1332 (ctpA)
    USA300_FPR3757:
    04-02981:
    SA2981_1374 (ctpA)
    08BA02176:
    C248_1460
    11819-97:
    MS7_1376
    71193:
    ST398NM01_1421
    ECT-R 2:
    ECTR2_1276
    ED133:
    SAOV_1429c
    ED98:
    SAAV_1403
    HO 5096 0412:
    SAEMRSA15_12830
    JH1:
    SaurJH1_1509
    JH9:
    SaurJH9_1480
    JKD6008:
    SAA6008_01388
    JKD6159:
    SAA6159_01287
    LGA251:
    SARLGA251_13360
    M013:
    M013TW_1366
    MRSA252:
    SAR1432
    MSHR1132:
    SAMSHR1132_12620
    MSSA476:
    SAS1363
    Mu3:
    SAHV_1408 (ctpA)
    Mu50:
    SAV1420 (ctpA)
    MW2:
    MW1310 (ctpA)
    RF122:
    SAB1275c
    ST398:
    SAPIG1421
    T0131:
    SAT0131_01500
    TCH60:
    HMPREF0772_11787
    TW20:
    SATW20_14210
    USA300_TCH1516:
    USA300HOU_1357 (ctpA)
    VC40:
    SAVC_06350

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDDKQHTSSSDDERAEIATSNQDQETNSSKRVHLKRWQFISILIGTILITAVITVVAYIF
    N315            MDDKQHTSSSDDERAEIATSNQDQETNSSKRVHLKRWQFISILIGTTLITAVITVVAYIF
    NCTC8325        MDDKQHTSSSDDERAEIATSNQDQETNSSKRVHLKRWQFISILIGTILITAVITVVAYIF
    Newman          MDDKQHTSSSDDERAEIATSNQDQETNSSKRVHLKRWQFISILIGTILITAVITVVAYIF
    USA300_FPR3757  MDDKQHTSSSDDERAEIATSNQDQETNSSKRVHLKRWQFISILIGTILITAVITVVAYIF
                    ********************************************** *************

    COL             INQKISGLNKTDQSNLNKIENVYKILNSDYYKKQDSDKLSKAAIDGMVKELKDPYSEYLT
    N315            INQKISGLNKTDQANLNKIENVYKILNSDYYKKQDSDKLSKAAIDGMVKELKDPYSEYLT
    NCTC8325        INQKISGLNKTDQANLNKIENVYKILNSDYYKKQDSDKLSKAAIDGMVKELKDPYSEYLT
    Newman          INQKISGLNKTDQANLNKIENVYKILNSDYYKKQDSDKLSKAAIDGMVKELKDPYSEYLT
    USA300_FPR3757  INQKISGLNKTDQANLNKIENVYKILNSDYYKKQDSDKLSKAAIDGMVKELKDPYSEYLT
                    *************:**********************************************

    COL             KEQTKSFNEGVSGDFVGIGAEMQKKNDQIMVTSPMKGSPAERAGIRPKDVITKVNGKSIK
    N315            KEQTKSFNEGVSGDFVGIGAEMQKKNDQIMVTSPMKGSPAERAGIRPKDVITKVNGKSIK
    NCTC8325        KEQTKSFNEGVSGDFVGIGAEMQKKNDQIMVTSPMKGSPAERAGIRPKDVITKVNGKSIK
    Newman          KEQTKSFNEGVSGDFVGIGAEMQKKNDQIMVTSPMKGSPAERAGIRPKDVITKVNGKSIK
    USA300_FPR3757  KEQTKSFNEGVSGDFVGIGAEMQKKNDQIMVTSPMKGSPAERAGIRPKDVITKVNGKSIK
                    ************************************************************

    COL             GKALDEVVKDVRGKENTEVTLTVQRGSEEKDVKIKREKIHVKSVEYKKKGKVGVITINKF
    N315            GKALDEVVKDVRGKENTEVTLTVQRGSEEKDVKIKREKIHVKSVDYKKKGKVGVITINKF
    NCTC8325        GKALDEVVKDVRGKENTEVTLTVQRGSEEKDVKIKREKIHVKSVEYKKKGKVGVITINKF
    Newman          GKALDEVVKDVRGKENTEVTLTVQRGSEEKDVKIKREKIHVKSVEYKKKGKVGVITINKF
    USA300_FPR3757  GKALDEVVKDVRGKENTEVTLTVQRGSEEKDVKIKREKIHVKSVEYKKKGKVGVITINKF
                    ********************************************:***************

    COL             QNDTSGELKDAVLKAHKDGLKKIVLDLRNNPGGLLDEAVKMANIFIDKGKTVVKLEKGKD
    N315            QNDTSGELKDAVLKAHKDGLKKIVLDLRNNPGGLLDEAVKMANIFIDKGKTVVKLEKGKD
    NCTC8325        QNDTSGELKDAVLKAHKDGLKKIVLDLRNNPGGLLDEAVKMANIFIDKGKTVVKLEKGKD
    Newman          QNDTSGELKDAVLKAHKDGLKKIVLDLRNNPGGLLDEAVKMANIFIDKGKTVVKLEKGKD
    USA300_FPR3757  QNDTSGELKDAVLKAHKDGLKKIVLDLRNNPGGLLDEAVKMANIFIDKGKTVVKLEKGKD
                    ************************************************************

    COL             TEAIQTSNDALKEAKDMDISILVNEGSASASEVFTGALKDYNKAKVYGSKTFGKGVVQTT
    N315            TEAIQTSNDSLKEAKDMDISILVNEGSASASEVFTGALKDYNKAKVYGSKTFGKGVVQTT
    NCTC8325        TEAIQTSNDALKEAKDMDISILVNEGSASASEVFTGALKDYNKAKVYGSKTFGKGVVQTT
    Newman          TEAIQTSNDALKEAKDMDISILVNEGSASASEVFTGALKDYNKAKVYGSKTFGKGVVQTT
    USA300_FPR3757  TEAIQTSNDALKEAKDMDISILVNEGSASASEVFTGALKDYNKAKVYGSKTFGKGVVQTT
                    *********:**************************************************

    COL             REFKDGSLLKYTEMKWLTPDGHYIHGKGIKPDVTIDTPKYQSLNVIPNTKTFKVGDDDKN
    N315            REFKDGSLLKYTEMKWLTPDGHYIHGKGIKPDVTIDTPKYQSLNVIPNTKTFKVGDDDKN
    NCTC8325        REFKDGSLLKYTEMKWLTPDGHYIHGKGIKPDVTIDTPKYQSLNVIPNTKTFKVGDDDKN
    Newman          REFKDGSLLKYTEMKWLTPDGHYIHGKGIKPDVTIDTPKYQSLNVIPNTKTFKVGDDDKN
    USA300_FPR3757  REFKDGSLLKYTEMKWLTPDGHYIHGKGIKPDVTIDTPKYQSLNVIPNTKTFKVGDDDKN
                    ************************************************************

    COL             IKTIKIGLSALGYKVDNESTQFDKALENQVKAFQQANKLEVTGEFNKETNNKFTELLVEK
    N315            IKTIKIGLSALGYKVDNESTQFDQALENQVKAFQQANKLEVTGEFNKETNNKFTELLVEK
    NCTC8325        IKTIKIGLSALGYKVDNESTQFDKALENQVKAFQQANKLEVTGEFNKETNNKFTELLVEK
    Newman          IKTIKIGLSALGYKVDNESTQFDKALENQVKAFQQANKLEVTGEFNKETNNKFTELLVEK
    USA300_FPR3757  IKTIKIGLSALGYKVDNESTQFDKALENQVKAFQQANKLEVTGEFNKETNNKFTELLVEK
                    ***********************:************************************

    COL             ANKHDDVLDKLINILK
    N315            ANKHDDVLDKLINILK
    NCTC8325        ANKHDDVLDKLINILK
    Newman          ANKHDDVLDKLINILK
    USA300_FPR3757  ANKHDDVLDKLINILK
                    ****************