From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003852000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 4137038..4137271
  • synteny block?: BlockID0029080
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1375
    08BA02176:
    C248_1461
    11819-97:
    MS7_1377
    71193:
    ST398NM01_1422
    ECT-R 2:
    ECTR2_1277
    ED133:
    SAOV_1430c
    ED98:
    SAAV_1404
    HO 5096 0412:
    SAEMRSA15_12840
    JH1:
    SaurJH1_1510
    JH9:
    SaurJH9_1481
    JKD6008:
    SAA6008_01389
    JKD6159:
    SAA6159_01288
    LGA251:
    SARLGA251_13370
    M013:
    M013TW_1367
    MRSA252:
    SAR1434
    MSHR1132:
    SAMSHR1132_12630
    MSSA476:
    SAS1364
    Mu3:
    SAHV_1409
    Mu50:
    SAV1421
    MW2:
    MW1311
    RF122:
    SAB1276c
    ST398:
    SAPIG1422
    T0131:
    SAT0131_01501
    TCH60:
    HMPREF0772_11785
    TW20:
    SATW20_14220
    USA300_TCH1516:
    USA300HOU_1358
    VC40:
    SAVC_06355

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKNYSFYQFVMTVRGRHDDKGRLAEEIFDDLAFPKHDDDFNILSDYIETHGDFTLPMSVF
    N315            MKNYSFYQFVMTVRGRHDDKGRLAEEIFDDLAFPKHDDDFNILSDYIETHGDFTLPMSVF
    NCTC8325        MKNYSFYQFVMTVRGRHDDKGRLAEEIFDDLAFPKHDDDFNILSDYIETHGDFTLPMSVF
    USA300_FPR3757  MKNYSFYQFVMTVRGRHDDKGRLAEEIFDDLAFPKHDDDFNILSDYIETHGDFTLPMSVF
                    ************************************************************

    COL             DDLYEEYTEWLKF
    N315            DDLYEEYTEWLKF
    NCTC8325        DDLYEEYTEWLKF
    USA300_FPR3757  DDLYEEYTEWLKF
                    *************