From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003863000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 4143711..4143848
  • synteny block?: BlockID0029190
  • occurrence?: in 72% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1385
    08BA02176:
    C248_1471
    11819-97:
    MS7_1387
    71193:
    ST398NM01_2880
    ECT-R 2:
    ED133:
    SAOV_1440c
    ED98:
    HO 5096 0412:
    SAEMRSA15_12940
    JH1:
    SaurJH1_1520
    JH9:
    SaurJH9_1491
    JKD6008:
    SAA6008_01399
    JKD6159:
    LGA251:
    SARLGA251_13470
    M013:
    MRSA252:
    SAR1444
    MSHR1132:
    MSSA476:
    SAS1374
    Mu3:
    SAHV_1419
    Mu50:
    SAV1431
    MW2:
    RF122:
    SAB1286c
    ST398:
    T0131:
    SAT0131_01512
    TCH60:
    HMPREF0772_11775
    TW20:
    SATW20_14320
    USA300_TCH1516:
    USA300HOU_1368
    VC40:
    SAVC_06405

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---------MSRILTFSEQNALAKIDDLMNTYCNQCPIKTRLRKLEGKTKAHHFCINECS
    N315            ------------MLTFSEQNTLAKIDDLMNTYCNQCPIKTRLRKLEGKTKAHHFCINECS
    NCTC8325        MQYFEVIKEVSRILTFSEQNALAKIDDLMNTYCNQCPIKTRLRKLEGKTKAHHFCINECS
                                :*******:***************************************

    COL             IGKEIKQLGNELQ
    N315            IGKEIKQLGNELQ
    NCTC8325        IGKEIKQLGNELQ
                    *************