From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003864000
  • symbol?:
  • description?: Putative preQ0 transporter

      descriptions from strain specific annotations:

    • Putative preQ0 transporter
    • membrane protein
    • conserved protein YpdP
    • membrane spanning protein
  • strand?: +
  • coordinates?: 4144150..4144674
  • synteny block?: BlockID0029200
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1386
    08BA02176:
    C248_1472
    11819-97:
    MS7_1388
    71193:
    ST398NM01_1432
    ECT-R 2:
    ECTR2_1287
    ED133:
    SAOV_1441
    ED98:
    SAAV_1414
    HO 5096 0412:
    SAEMRSA15_12950
    JH1:
    SaurJH1_1521
    JH9:
    SaurJH9_1492
    JKD6008:
    SAA6008_01400
    JKD6159:
    SAA6159_01298
    LGA251:
    SARLGA251_13480
    M013:
    M013TW_1378
    MRSA252:
    SAR1445
    MSHR1132:
    SAMSHR1132_12730
    MSSA476:
    SAS1375
    Mu3:
    SAHV_1420
    Mu50:
    SAV1432
    MW2:
    MW1321
    RF122:
    SAB1287
    ST398:
    SAPIG1432
    T0131:
    SAT0131_01513
    TCH60:
    HMPREF0772_11774
    TW20:
    SATW20_14330
    USA300_TCH1516:
    USA300HOU_1369
    VC40:
    SAVC_06410

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MYNEILGLVTFIATFVLMVLMYRFFGKQGLIAWVAIGTIIANIQVIKTVEIFGISATLGN
    N315            MYNEILGLVTFIATFVLMVLMYRFFGKQGLIAWVAIGTIIANIQVIKTVEIFGISATLGN
    NCTC8325        MYNEILGLVTFIATFVLMVLMYRFFGKQGLIAWVAIGTIIANIQVIKTVEIFGISATLGN
    Newman          MYNEILGLVTFIATFVLMVLMYRFFGKQGLIAWVAIGTIIANIQVIKTVEIFGISATLGN
    USA300_FPR3757  MYNEILGLVTFIATFVLMVLMYRFFGKQGLIAWVAIGTIIANIQVIKTVEIFGISATLGN
                    ************************************************************

    COL             VMFASIYLATDILNDIYGRRVAKRAVWLGFSSTLIMIIVMQLSLHFIPAPEDMAQKALHA
    N315            VMFASIYLATDILNDIYGRRVAKRAVWLGFSSTLIMIIVMQLSLHFIPAPEDMAQKALHA
    NCTC8325        VMFASIYLATDILNDIYGRRVAKRAVWLGFSSTLIMIIVMQLSLHFIPAPEDMAQKALHA
    Newman          VMFASIYLATDILNDIYGRRVAKRAVWLGFSSTLIMIIVMQLSLHFIPAPEDMAQKALHA
    USA300_FPR3757  VMFASIYLATDILNDIYGRRVAKRAVWLGFSSTLIMIIVMQLSLHFIPAPEDMAQKALHA
                    ************************************************************

    COL             IFDVVPRIALGSIVAYIIGQHIDVFIFSLIKKVFSSDKTFFIRAYGSTFLSSIIDTALFV
    N315            IFDVVPRIALGSIVAYIIGQHIDVFIFSLIKKVFSSDKTFFIRAYGSTFLSSIIDTALFV
    NCTC8325        IFDVVPRIALGSIVAYIIGQHIDVFIFSLIKKVFSSDKTFFIRAYGSTFLSSIIDTALFV
    Newman          IFDVVPRIALGSIVAYIIGQHIDVFIFSLIKKVFSSDKTFFIRAYGSTFLSSIIDTALFV
    USA300_FPR3757  IFDVVPRIALGSIVAYIIGQHIDVFIFSLIKKVFSSDKTFFIRAYGSTFLSSIIDTALFV
                    ************************************************************

    COL             AIAFIGSLPGTVVFEIFITTYVLKLASTVFNVPFGYIAKSFYRKGKIDKLDQGY
    N315            AIAFIGSLPGTVVFEIFITTYVLKLASTVFNVPFGYIAKSFYRKGKIDKLDQGY
    NCTC8325        AIAFIGSLPGTVVFEIFITTYVLKLASTVFNVPFGYIAKSFYRKGKIDKLDQGY
    Newman          AIAFIGSLPGTVVFEIFITTYVLKLASTVFNVPFGYIAKSFYRKGKIDKLDQGY
    USA300_FPR3757  AIAFIGSLPGTVVFEIFITTYVLKLASTVFNVPFGYIAKSFYRKGKIDKLDQGY
                    ******************************************************