From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003890000
  • symbol?: norB
  • description?: major facilitator superfamily transporter

      descriptions from strain specific annotations:

    • major facilitator superfamily transporter
    • major facilitator transporter
    • putative transporter
    • major facilitator superfamily protein
    • drug transporter, putative
    • transporter protein
    • transmembrane efflux protein
    • putative drug transporter
    • Major facilitator family transporter
    • quinolone resistance protein norB
    • multidrug resistance protein B
  • strand?: -
  • coordinates?: 4210227..4211632
  • synteny block?: BlockID0029360
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1391
    08BA02176:
    C248_1475
    11819-97:
    MS7_1392
    71193:
    ST398NM01_1435
    ECT-R 2:
    ECTR2_1290
    ED133:
    SAOV_1445
    ED98:
    SAAV_1420
    HO 5096 0412:
    SAEMRSA15_12980
    JH1:
    SaurJH1_1525
    JH9:
    SaurJH9_1496
    JKD6008:
    SAA6008_01404
    JKD6159:
    SAA6159_01301
    LGA251:
    SARLGA251_13510
    M013:
    M013TW_1383
    MRSA252:
    SAR1448
    MSHR1132:
    SAMSHR1132_12770
    MSSA476:
    SAS1379
    Mu3:
    SAHV_1424
    Mu50:
    SAV1436
    MW2:
    MW1325
    RF122:
    SAB1301c
    ST398:
    SAPIG1435
    T0131:
    SAT0131_01522
    TCH60:
    HMPREF0772_11770
    TW20:
    SATW20_14360
    USA300_TCH1516:
    USA300HOU_1373
    VC40:
    SAVC_06435

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEKPSREAFEGNNKLLIGIVLSVITFWLFAQSLVNVVPILEDSFNTDIGTVNIAVSITAL
    N315            MEKPSREAFEGNNKLLIGIVLSVITFWLFAQSLVNVVPILEDSFNTDIGTVNIAVSITAL
    NCTC8325        MEKPSREAFEGNNKLLIGIVLSVITFWLFAQSLVNVVPILEDSFNTDIGTVNIAVSITAL
    Newman          MEKPSREAFEGNNKLLIGIVLSVITFWLFAQSLVNVVPILEDSFNTDIGTVNIAVSITAL
    USA300_FPR3757  MEKPSREAFEGNNKLLIGIVLSVITFWLFAQSLVNVVPILEDSFNTDIGTVNIAVSITAL
                    ************************************************************

    COL             FSGMFVVGAGGLADKYGRIKLTNIGIILNILGSLLIIISNIPLLLIIGRLIQGLSAACIM
    N315            FSGMFVVGAGGLADKYGRIKLTNIGIILNILGSLLIIISNIPLLLIIGRLIQGLSAACIM
    NCTC8325        FSGMFVVGAGGLADKYGRIKLTNIGIILNILGSLLIIISNIPLLLIIGRLIQGLSAACIM
    Newman          FSGMFVVGAGGLADKYGRIKLTNIGIILNILGSLLIIISNIPLLLIIGRLIQGLSAACIM
    USA300_FPR3757  FSGMFVVGAGGLADKYGRIKLTNIGIILNILGSLLIIISNIPLLLIIGRLIQGLSAACIM
                    ************************************************************

    COL             PATLSIIKSYYIGKDRQRALSYWSIGSWGGSGVCSFFGGAVATLLGWRWIFILSIIISLI
    N315            PATLSIIKSYYIGKDRQRALSYWSIGSWGGSGVCSFFGGAVATLLGWRWIFILSIIISLI
    NCTC8325        PATLSIIKSYYIGKDRQRALSYWSIGSWGGSGVCSFFGGAVATLLGWRWIFILSIIISLI
    Newman          PATLSIIKSYYIGKDRQRALSYWSIGSWGGSGVCSFFGGAVATLLGWRWIFILSIIISLI
    USA300_FPR3757  PATLSIIKSYYIGKDRQRALSYWSIGSWGGSGVCSFFGGAVATLLGWRWIFILSIIISLI
                    ************************************************************

    COL             ALFLIKGTPETKSKSISLNKFDIKGLVLLVIMLLSLNILITKGSELGVTSLLFITLLAIA
    N315            ALFLIKGTPETKSKSISLNKFDIKGLVLLVIMLLTLNILITKGSELGVTSLLFITLLAIA
    NCTC8325        ALFLIKGTPETKSKSISLNKFDIKGLVLLVIMLLSLNILITKGSELGVTSLLFITLLAIA
    Newman          ALFLIKGTPETKSKSISLNKFDIKGLVLLVIMLLSLNILITKGSELGVTSLLFITLLAIA
    USA300_FPR3757  ALFLIKGTPETKSKSISLNKFDIKGLVLLVIMLLSLNILITKGSELGVTSLLFITLLAIA
                    **********************************:*************************

    COL             IGSFSLFIVLEKRATNPLIDFKLFKNKAYTGATASNFLLNGVAGTLIVANTFVQRGLGYS
    N315            IGSFSLFIVLEKRATNPLIDFKLFKNKAYTGATASNFLLNGVAGTLIVANTFVQRGLGYS
    NCTC8325        IGSFSLFIVLEKRATNPLIDFKLFKNKAYTGATASNFLLNGVAGTLIVANTFVQRGLGYS
    Newman          IGSFSLFIVLEKRATNPLIDFKLFKNKAYTGATASNFLLNGVAGTLIVANTFVQRGLGYS
    USA300_FPR3757  IGSFSLFIVLEKRATNPLIDFKLFKNKAYTGATASNFLLNGVAGTLIVANTFVQRGLGYS
                    ************************************************************

    COL             SLQAGSLSITYLVMVLIMIRVGEKLLQTLGCKKPMLIGTGVLIVGECLISLTFLPEIFYV
    N315            SLQAGSLSITYLVMVLIMIRVGEKLLQTLGCKKPMLIGTGVLIVGECLISLTFLPEILYV
    NCTC8325        SLQAGSLSITYLVMVLIMIRVGEKLLQTLGCKKPMLIGTGVLIVGECLISLTFLPEIFYV
    Newman          SLQAGSLSITYLVMVLIMIRVGEKLLQTLGCKKPMLIGTGVLIVGECLISLTFLPEIFYV
    USA300_FPR3757  SLQAGSLSITYLVMVLIMIRVGEKLLQTLGCKKPMLIGTGVLIVGECLISLTFLPEIFYV
                    *********************************************************:**

    COL             ICCIIGYLFFGLGLGIYATPSTDTAIANAPLEKVGVAAGIYKMASALGGAFGVALSGAVY
    N315            ICCIIGYLFFGLGLGIYATPSTDTAIANAPLEKVGVAAGIYKMASALGGAFGVALSGAVY
    NCTC8325        ICCIIGYLFFGLGLGIYATPSTDTAIANAPLEKVGVAAGIYKMASALGGAFGVALSGAVY
    Newman          ICCIIGYLFFGLGLGIYATPSTDTAIANAPLEKVGVAAGIYKMASALGGAFGVALSGAVY
    USA300_FPR3757  ICCIIGYLFFGLGLGIYATPSTDTAIANAPLEKVGVAAGIYKMASALGGAFGVALSGAVY
                    ************************************************************

    COL             AIVSNMTNIYTGAMIALWLNAAMGILSFVIILLLVPKQNDTQL
    N315            AIVSNMTNIYTGAMIALWLNAGMGILSFVIILLLVPKQNDTQL
    NCTC8325        AIVSNMTNIYTGAMIALWLNAGMGILSFVIILLLVPKQNDTQL
    Newman          AIVSNMTNIYTGAMIALWLNAGMGILSFVIILLLVPKQNDTQL
    USA300_FPR3757  AIVSNMTNIYTGAMIALWLNAGMGILSFVIILLLVPKQNDTQL
                    *********************.*********************