From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003891000
  • symbol?:
  • description?: amino acid permease

      descriptions from strain specific annotations:

    • amino acid permease
    • amino acid permease family protein
    • serine/threonine exchanger SteT
    • APC family amino acid-polyamine-organocation transporter
    • fructoselysine transporter
    • Amino acid permease-associated region
    • amino acid ABC transporter permease
    • APC family amino acid transporter
  • strand?: -
  • coordinates?: 4211787..4213122
  • synteny block?: BlockID0029370
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1392
    08BA02176:
    C248_1476
    11819-97:
    MS7_1393 (steT)
    71193:
    ST398NM01_1436
    ECT-R 2:
    ECTR2_1291
    ED133:
    SAOV_1446
    ED98:
    SAAV_1421
    HO 5096 0412:
    SAEMRSA15_12990
    JH1:
    SaurJH1_1526
    JH9:
    SaurJH9_1497
    JKD6008:
    SAA6008_01405 (frlA)
    JKD6159:
    SAA6159_01302 (frlA)
    LGA251:
    SARLGA251_13520
    M013:
    M013TW_1384
    MRSA252:
    SAR1449
    MSHR1132:
    SAMSHR1132_12780
    MSSA476:
    SAS1380
    Mu3:
    SAHV_1425
    Mu50:
    SAV1437
    MW2:
    MW1326
    RF122:
    SAB1302c
    ST398:
    SAPIG1436
    T0131:
    SAT0131_01525
    TCH60:
    HMPREF0772_11769
    TW20:
    SATW20_14370
    USA300_TCH1516:
    USA300HOU_1374
    VC40:
    SAVC_06440

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSNGKELQKNIGFFSAFAIVMGTVIGSGVFFKISNVTEVTGTAGMALFVWFLGGIITICA
    N315            MSNGKELQKNIGFFSAFAIVMGTVIGSGVFFKISNVTEVTGTAGMALFVWFLGGIITICA
    NCTC8325        MSNGKELQKNIGFFSAFAIVMGTVIGSGVFFKISNVTEVTGTAGMALFVWFLGGIITICA
    Newman          MSNGKELQKNIGFFSAFAIVMGTVIGSGVFFKISNVTEVTGTAGMALFVWFLGGIITICA
    USA300_FPR3757  MSNGKELQKNIGFFSAFAIVMGTVIGSGVFFKISNVTEVTGTAGMALFVWFLGGIITICA
                    ************************************************************

    COL             GLTAAELAAAIPETGGLTKYIEYTYGDFWGFLSGWAQSFIYFPANVAALSIVFATQLINL
    N315            GLTAAELAAAIPETGGLTKYIEYTYGDFWGFLSGWAQSFIYFPANVAALSIVFATQLINL
    NCTC8325        GLTAAELAAAIPETGGLTKYIEYTYGDFWGFLSGWAQSFIYFPANVAALSIVFATQLINL
    Newman          GLTAAELAAAIPETGGLTKYIEYTYGDFWGFLSGWAQSFIYFPANVAALSIVFATQLINL
    USA300_FPR3757  GLTAAELAAAIPETGGLTKYIEYTYGDFWGFLSGWAQSFIYFPANVAALSIVFATQLINL
                    ************************************************************

    COL             FHLSIGSLIPIAIASALSIVLINFLGSKAGGILQSVTLVIKLIPIIVIVIFGIFQSGDIT
    N315            FHLSIGSLIPIAIASALSIVLINFLGSKAGGILQSVTLVIKLIPIIVIVIFGIFQSGDIT
    NCTC8325        FHLSIGSLIPIAIASALSIVLINFLGSKAGGILQSVTLVIKLIPIIVIVIFGIFQSGDIT
    Newman          FHLSIGSLIPIAIASALSIVLINFLGSKAGGILQSVTLVIKLIPIIVIVIFGIFQSGDIT
    USA300_FPR3757  FHLSIGSLIPIAIASALSIVLINFLGSKAGGILQSVTLVIKLIPIIVIVIFGIFQSGDIT
                    ************************************************************

    COL             FSLIPTTGNSGNGFFTAIGSGLLATMFAYDGWIHVGNVAGELKNPKRDLPLAISVGIGCI
    N315            FSLIPTTGNSGNGFFTAIGSGLLATMFAYDGWIHVGNVAGELKNPKRDLPLAISVGIGCI
    NCTC8325        FSLIPTTGNSGNGFFTAIGSGLLATMFAYDGWIHVGNVAGELKNPKRDLPLAISVGIGCI
    Newman          FSLIPTTGNSGNGFFTAIGSGLLATMFAYDGWIHVGNVAGELKNPKRDLPLAISVGIGCI
    USA300_FPR3757  FSLIPTTGNSGNGFFTAIGSGLLATMFAYDGWIHVGNVAGELKNPKRDLPLAISVGIGCI
                    ************************************************************

    COL             MAVYLLINATFLLTLPIELLAGNLNAASDTSKILFGENGGKIITIGILISVYGTINGYTM
    N315            MAVYLLINATFLLTLPIELLAGNLNAASDTSKILFGENGGKIITIGILISVYGTINGYTM
    NCTC8325        MAVYLLINATFLLTLPIELLAGNLNAASDTSKILFGENGGKIITIGILISVYGTINGYTM
    Newman          MAVYLLINATFLLTLPIELLAGNLNAASDTSKILFGENGGKIITIGILISVYGTINGYTM
    USA300_FPR3757  MAVYLLINATFLLTLPIELLAGNLNAASDTSKILFGENGGKIITIGILISVYGTINGYTM
                    ************************************************************

    COL             TGMRVPYAMAERKLLPFSHLFAKLTKSGAPWFGAIIQLIIAIIMMSMGAFDTITNMLIFV
    N315            TGMRVPYAMAERKLLPFSHLFAKLTKSGAPWFGAIIQLIIAIIMMSMGAFDTITNMLIFV
    NCTC8325        TGMRVPYAMAERKLLPFSHLFAKLTKSGAPWFGAIIQLIIAIIMMSMGAFDTITNMLIFV
    Newman          TGMRVPYAMAERKLLPFSHLFAKLTKSGAPWFGAIIQLIIAIIMMSMGAFDTITNMLIFV
    USA300_FPR3757  TGMRVPYAMAERKLLPFSHLFAKLTKSGAPWFGAIIQLIIAIIMMSMGAFDTITNMLIFV
                    ************************************************************

    COL             IWLFYCMSFVAVIILRKREPNMERPYKVPLYPIIPLIAILAGSFVLINTLFTQFILAIIG
    N315            IWLFYCMSFVAVIILRKREPNMERPYKVPLYPIIPLIAILAGSFVLINTLFTQFILAIIG
    NCTC8325        IWLFYCMSFVAVIILRKREPNMERPYKVPLYPIIPLIAILAGSFVLINTLFTQFILAIIG
    Newman          IWLFYCMSFVAVIILRKREPNMERPYKVPLYPIIPLIAILAGSFVLINTLFTQFILAIIG
    USA300_FPR3757  IWLFYCMSFVAVIILRKREPNMERPYKVPLYPIIPLIAILAGSFVLINTLFTQFILAIIG
                    ************************************************************

    COL             ILITALGIPVYYYKKKQKAS
    N315            ILITALGIPVYYYKKKQKAA
    NCTC8325        ILITALGIPVYYYKKKQKAA
    Newman          ILITALGIPVYYYKKKQKAA
    USA300_FPR3757  ILITALGIPVYYYKKKQKAA
                    *******************: