From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003900000
  • symbol?:
  • description?: N6-adenine-specific DNA methylase

      descriptions from strain specific annotations:

    • N6-adenine-specific DNA methylase
    • RNA methylase family protein
    • putative N6-adenine-specific DNA methylase
    • site-specific DNA-methyltransferase (adenine-specific)
    • protein YpsC
    • Methyltransferase
  • strand?: -
  • coordinates?: 4223079..4224224
  • synteny block?: BlockID0029460
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1399
    08BA02176:
    C248_1483
    11819-97:
    MS7_1400
    71193:
    ST398NM01_1443
    ECT-R 2:
    ECTR2_1298
    ED133:
    SAOV_1453
    ED98:
    SAAV_1428
    HO 5096 0412:
    SAEMRSA15_13060
    JH1:
    SaurJH1_1533
    JH9:
    SaurJH9_1504
    JKD6008:
    SAA6008_01412
    JKD6159:
    SAA6159_01309
    LGA251:
    SARLGA251_13590
    M013:
    M013TW_1391
    MRSA252:
    SAR1456
    MSHR1132:
    SAMSHR1132_12850
    MSSA476:
    SAS1387
    Mu3:
    SAHV_1432
    Mu50:
    SAV1444
    MW2:
    MW1333
    RF122:
    SAB1309c
    ST398:
    SAPIG1443
    T0131:
    SAT0131_01532
    TCH60:
    HMPREF0772_11760
    TW20:
    SATW20_14440
    USA300_TCH1516:
    USA300HOU_1381
    VC40:
    SAVC_06475

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFQLLAVCPMGLEAVVAREIQELGYETNVENGRIFFEGDASAIVKANLWLRTADRIKIVV
    N315            MFQLLAVCPMGLEAVVAREIQELGYETNVENGRIFFEGDASAIVKANLWLRTADRIKIVV
    NCTC8325        MFQLLAVCPMGLEAVVAREIQELGYETNVENGRIFFEGDASAIVKANLWLRTADRIKIVV
    Newman          MFQLLAVCPMGLEAVVAREIQELGYETNVENGRIFFEGDASAIVKANLWLRTADRIKIVV
    USA300_FPR3757  MFQLLAVCPMGLEAVVAREIQELGYETNVENGRIFFEGDASAIVKANLWLRTADRIKIVV
                    ************************************************************

    COL             GRFNATTFDELFEQTKALPWESIIDKEGNFPVQGRSVKSTLHSVPDCQAITKKAIVERLR
    N315            GRFNATTFDELFEQTKALPWESIIDKEGNFPVQGRSVKSTLHSVPDCQAITKKAIVERLR
    NCTC8325        GRFNATTFDELFEQTKALPWESIIDKEGNFPVQGRSVKSTLHSVPDCQAITKKAIVERLR
    Newman          GRFNATTFDELFEQTKALPWESIIDKEGNFPVQGRSVKSTLHSVPDCQAITKKAIVERLR
    USA300_FPR3757  GRFNATTFDELFEQTKALPWESIIDKEGNFPVQGRSVKSTLHSVPDCQAITKKAIVERLR
                    ************************************************************

    COL             RAYNEKGWLNESGAKYPVEVAILKDNVLLTIDTSGSGLNRRGYRLAQGEAPIKETLAASL
    N315            RAYNEKGWLNESGAKYPVEVAILKDNVLLTIDTSGSGLNRRGYRLAQGEAPIKETLAASL
    NCTC8325        RAYNEKGWLNESGAKYPVEVAILKDNVLLTIDTSGSGLNRRGYRLAQGEAPIKETLAASL
    Newman          RAYNEKGWLNESGAKYPVEVAILKDNVLLTIDTSGSGLNRRGYRLAQGEAPIKETLAASL
    USA300_FPR3757  RAYNEKGWLNESGAKYPVEVAILKDNVLLTIDTSGSGLNRRGYRLAQGEAPIKETLAASL
                    ************************************************************

    COL             IRLANWKGDTPLIDPFCGSGTIAIEACLIAQNIAPGFNREFVSEQWNIMPANIYDDYRDE
    N315            IRLANWKGDTPLIDPFCGSGTIAIEACLIAQNIAPGFNREFVSEQWNIMPANIYDDYRDE
    NCTC8325        IRLANWKGDTPLIDPFCGSGTIAIEACLIAQNIAPGFNREFVSEQWNIMPANIYDDYRDE
    Newman          IRLANWKGDTPLIDPFCGSGTIAIEACLIAQNIAPGFNREFVSEQWNIMPANIYDDYRDE
    USA300_FPR3757  IRLANWKGDTPLIDPFCGSGTIAIEACLIAQNIAPGFNREFVSEQWNIMPANIYDDYRDE
                    ************************************************************

    COL             ADKMADYDKEIEVYASDIDPEMVEIAKRNAEEVGLSDIIKFSVKDVNTLTIDTEEPVALI
    N315            ADKMADYDKEIEVYASDIDPEMVEIAKRNAEEVGLSDIIKFSVKDVNTLTIDTEEPVALI
    NCTC8325        ADKMADYDKEIEVYASDIDPEMVEIAKRNAEEVGLSDIIKFSVKDVNTLTIDTEEPVALI
    Newman          ADKMADYDKEIEVYASDIDPEMVEIAKRNAEEVGLSDIIKFSVKDVNTLTIDTEEPVALI
    USA300_FPR3757  ADKMADYDKEIEVYASDIDPEMVEIAKRNAEEVGLSDIIKFSVKDVNTLTIDTEEPVALI
                    ************************************************************

    COL             GNPPYGERIGDREEVEEMYRYIGKLMKQHPFLSTYILTSNKEFEYLVDRKATKRRKLFNG
    N315            GNPPYGERIGDREEVEEMYRYIGKLMKQHPFLSTYILTSNKEFEYLVNRKATKRRKLFNG
    NCTC8325        GNPPYGERIGDREEVEEMYRYIGKLMKQHPFLSTYILTSNKEFEYLVDRKATKRRKLFNG
    Newman          GNPPYGERIGDREEVEEMYRYIGKLMKQHPFLSTYILTSNKEFEYLVDRKATKRRKLFNG
    USA300_FPR3757  GNPPYGERIGDREEVEEMYRYIGKLMKQHPFLSTYILTSNKEFEYLVDRKATKRRKLFNG
                    ***********************************************:************

    COL             YIECTYYQYWGKKTERKTIEN
    N315            YIECTYYQYWGKKTERKTIEN
    NCTC8325        YIECTYYQYWGKKTERKTIEN
    Newman          YIECTYYQYWGKKTERKTIEN
    USA300_FPR3757  YIECTYYQYWGKKTERKTIEN
                    *********************