From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003911000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 4230320..4230661
  • synteny block?: BlockID0029570
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1407
    08BA02176:
    C248_1491
    11819-97:
    MS7_1407
    71193:
    ST398NM01_1451
    ECT-R 2:
    ECTR2_1305
    ED133:
    SAOV_1459
    ED98:
    SAAV_1438
    HO 5096 0412:
    SAEMRSA15_13120
    JH1:
    SaurJH1_1539
    JH9:
    SaurJH9_1510
    JKD6008:
    SAA6008_01420
    JKD6159:
    SAA6159_01316
    LGA251:
    SARLGA251_13650
    M013:
    M013TW_1399
    MRSA252:
    SAR1462
    MSHR1132:
    SAMSHR1132_12910
    MSSA476:
    SAS1394
    Mu3:
    SAHV_1439
    Mu50:
    SAV1451
    MW2:
    MW1341
    RF122:
    SAB1315c
    ST398:
    SAPIG1451
    T0131:
    SAT0131_01540
    TCH60:
    HMPREF0772_11753
    TW20:
    SATW20_14500
    USA300_TCH1516:
    USA300HOU_1389
    VC40:
    SAVC_06510

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTNITKEVFDNLEQEIDLFAKNKTLGSSEAKPYLDEYHSKIIDYFKQVNDITGNIDFDKL
    N315            MTNITKEVFDNLEQEIDVFAKNKALGSSEAKPYLDEYHSKIIDYFKQVNDITSNIDFDNL
    NCTC8325        MTNITKEVFDNLEQEIDLFAKNKTLGSSEAKPYLDEYHSKIIDYFKQVNDITGNIDFDKL
    Newman          MTNITKEVFDNLEQEIDLFAKNKTLGSSEAKPYLDEYHSKIIDYFKQVNDITGNIDFDKL
    USA300_FPR3757  MTNITKEVFDNLEQEIDLFAKNKTLGSSEAKPYLDEYHSKIIDYFKQVNDITGNIDFDKL
                    *****************:*****:****************************.*****:*

    COL             NQYPVVPMNFKERYDYMIERKYHFMGYRQMKTFKTELIKMNASYQTRLKNKQV
    N315            NQYPVVPMNFKERYDYMIERKYHFMGYRQMKTFKTELIKMNASYQTRLKNKQV
    NCTC8325        NQYPVVPMNFKERYDYMIERKYHFMGYRQMKTFKTELIKMNASYQTRLKNKQV
    Newman          NQYPVVPMNFKERYDYMIERKYHFMGYRQMKTFKTELIKMNASYQTRLKNKQV
    USA300_FPR3757  NQYPVVPMNFKERYDYMIERKYHFMGYRQMKTFKTELIKMNASYQTRLKNKQV
                    *****************************************************