From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003912000
  • symbol?: nth
  • description?: endonuclease-like protein

      descriptions from strain specific annotations:

    • endonuclease-like protein
    • endonuclease III
    • DNA-(apurinic or apyrimidinic site) lyase
    • putative endonuclease
    • Endonuclease III / DNA-(Apurinic or apyrimidinic site) lyase
    • endonuclease III-like protein
  • strand?: -
  • coordinates?: 4230666..4231325
  • synteny block?: BlockID0029580
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1492 (nth)
    N315:
    SA1285 (nth)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1408 (nth)
    08BA02176:
    C248_1492
    11819-97:
    MS7_1408 (nth)
    71193:
    ST398NM01_1452
    ECT-R 2:
    ECTR2_1306 (nth)
    ED133:
    SAOV_1460
    ED98:
    SAAV_1439 (nth)
    HO 5096 0412:
    SAEMRSA15_13130
    JH1:
    SaurJH1_1540
    JH9:
    SaurJH9_1511
    JKD6008:
    SAA6008_01421 (nth)
    JKD6159:
    SAA6159_01317 (nth)
    LGA251:
    SARLGA251_13660
    M013:
    M013TW_1400
    MRSA252:
    SAR1463
    MSHR1132:
    SAMSHR1132_12920
    MSSA476:
    SAS1395
    Mu3:
    SAHV_1440 (nth)
    Mu50:
    SAV1452 (nth)
    MW2:
    MW1342 (nth)
    RF122:
    SAB1316c
    ST398:
    SAPIG1452 (nth)
    T0131:
    SAT0131_01541
    TCH60:
    HMPREF0772_11752 (nth)
    TW20:
    SATW20_14510
    USA300_TCH1516:
    USA300HOU_1390 (nth)
    VC40:
    SAVC_06515

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVSKKKALEMIDVIANMFPDAECELKHDNPFELTIAVLLSAQCTDVLVNRVTTELFKKYK
    N315            MVSKKKALEMIDVIANMFPDAECELKHDNPFELTIAVLLSAQCTDVLVNRVTTELFKKYK
    NCTC8325        MVSKKKALEMIDVIANMFPDAECELKHDNPFELTIAVLLSAQCTDVLVNRVTTELFKKYK
    Newman          MVSKKKALEMIDVIANMFPDAECELKHDNPFELTIAVLLSAQCTDVLVNRVTTELFKKYK
    USA300_FPR3757  MVSKKKALEMIDVIANMFPDAECELKHDNPFELTIAVLLSAQCTDVLVNRVTTELFKKYK
                    ************************************************************

    COL             TPEDYLAVSDEELMNDIRSIGLYRNKAKNIKKLCQSLIDQFNGEIPQTHKELESLAGVGR
    N315            TPEDYLAVSDEELMNDIRSIGLYRNKAKNIKKLCQSLIDQFNGEIPQTHKELESLAGVGR
    NCTC8325        TPEDYLAVSDEELMNDIRSIGLYRNKAKNIKKLCQSLIDQFNGEIPQTHKELESLAGVGR
    Newman          TPEDYLAVSDEELMNDIRSIGLYRNKAKNIKKLCQSLIDQFNGEIPQTHKELESLAGVGR
    USA300_FPR3757  TPEDYLAVSDEELMNDIRSIGLYRNKAKNIKKLCQSLIDQFNGEIPQTHKELESLAGVGR
                    ************************************************************

    COL             KTANVVMSVAFDEPSLAVDTHVERVSKRLGINRWKDNVRQVEDRLCSVIPRDRWNRSHHQ
    N315            KTANVVMSVAFDEPSLAVDTHVERVSKRLGINRWKDNVRQVEDRLCSVIPRDRWNRSHHQ
    NCTC8325        KTANVVMSVAFDEPSLAVDTHVERVSKRLGINRWKDNVRQVEDRLCSVIPRDRWNRSHHQ
    Newman          KTANVVMSVAFDEPSLAVDTHVERVSKRLGINRWKDNVRQVEDRLCSVIPRDRWNRSHHQ
    USA300_FPR3757  KTANVVMSVAFDEPSLAVDTHVERVSKRLGINRWKDNVRQVEDRLCSVIPRDRWNRSHHQ
                    ************************************************************

    COL             LIFFGRYHCLARKPKCDICPLLEDCREGQKRYKASLKEA
    N315            LIFFGRYHCLARKPKCDICPLLEDCREGQKRYKASLKEA
    NCTC8325        LIFFGRYHCLARKPKCDICPLLEDCREGQKRYKASLKEA
    Newman          LIFFGRYHCLARKPKCDICPLLEDCREGQKRYKASLKEA
    USA300_FPR3757  LIFFGRYHCLARKPKCDICPLLEDCREGQKRYKASLKEA
                    ***************************************