From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003915000
  • symbol?: dinG
  • description?: ATP-dependent helicase DinG

      descriptions from strain specific annotations:

    • ATP-dependent helicase DinG
    • DnaQ family exonuclease/DinG family helicase
    • DNA polymerase III subunit epsilon/ATP-dependent helicase DinG
    • ATP-dependent DNA helicase DinG
    • DnaQ family exonuclease
    • DinG family ATP-dependent helicase YoaA
    • ATP-dependent helicase dinG -like protein
    • DNA-directed DNA polymerase III epsilon subunit
    • DNA-directed DNA polymerase III subunit epsilon
    • DNA polymerase III, epsilon subunit
    • DNA polymerase III, epsilon subunit/ATP-dependent helicase DinG
    • DnaQ family exonuclease/DinG family helicase, putative
    • putative ATP-dependent helicase, DinG family protein
  • strand?: -
  • coordinates?: 4234001..4236722
  • synteny block?: BlockID0029610
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1288 (dinG)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1411 (dinG)
    08BA02176:
    C248_1495
    11819-97:
    MS7_1411
    71193:
    ST398NM01_1455
    ECT-R 2:
    ECTR2_1309
    ED133:
    SAOV_1463 (dinG)
    ED98:
    SAAV_1442
    HO 5096 0412:
    SAEMRSA15_13160
    JH1:
    SaurJH1_1543
    JH9:
    SaurJH9_1514
    JKD6008:
    SAA6008_01424 (dinG)
    JKD6159:
    SAA6159_01320 (dinG)
    LGA251:
    SARLGA251_13690
    M013:
    M013TW_1403
    MRSA252:
    SAR1466
    MSHR1132:
    SAMSHR1132_12950
    MSSA476:
    SAS1398
    Mu3:
    SAHV_1443 (dinG)
    Mu50:
    SAV1455 (dinG)
    MW2:
    MW1345 (dinG)
    RF122:
    SAB1319c (dinG)
    ST398:
    SAPIG1455
    T0131:
    SAT0131_01544
    TCH60:
    HMPREF0772_11749 (dnaQ)
    TW20:
    SATW20_14540
    USA300_TCH1516:
    USA300HOU_1393 (dnaQ)
    VC40:
    SAVC_06530

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGMATYAVVDLETTGNQLDFDDIIQIGITFVRNNQIIDTYHSMIRTNLEIPPFIQALTSI
    N315            MGMATYAVVDLETTGNQLDFDDIIQIGITFVRNNQIIDTYHSMIRTNLEIPPFIQALTSI
    NCTC8325        MGMATYAVVDLETTGNQLDFDDIIQIGITFVRNNQIIDTYHSMIRTNLEIPPFIQALTSI
    Newman          MGMATYAVVDLETTGNQLDFDDIIQIGITFVRNNQIIDTYHSMIRTNLEIPPFIQALTSI
    USA300_FPR3757  MGMATYAVVDLETTGNQLDFDDIIQIGITFVRNNQIIDTYHSMIRTNLEIPPFIQALTSI
                    ************************************************************

    COL             EENMLQQAPYFNQVAQEIYDKIKDCIFVAHNVDFDLNFIKKAFKDCNIQYRPKKVIDTLE
    N315            EENMLQQAPYFNQVAQEIYDKIKDCIFVAHNVDFDLNFIKKAFKDCNIQYRPKKVIDTLE
    NCTC8325        EENMLQQAPYFNQVAQEIYDKIKDCIFVAHNVDFDLNFIKKAFKDCNIQYRPKKVIDTLE
    Newman          EENMLQQAPYFNQVAQEIYDKIKDCIFVAHNVDFDLNFIKKAFKDCNIQYRPKKVIDTLE
    USA300_FPR3757  EENMLQQAPYFNQVAQEIYDKIKDCIFVAHNVDFDLNFIKKAFKDCNIQYRPKKVIDTLE
                    ************************************************************

    COL             IFKIAFPTDKSYQLSELAEAHGITLANAHRADEDAATTAKLMILAFEKFEKLPLDTLKQL
    N315            IFKIAFPTDKSYQLSELAEAHGITLANAHRADEDAATTAKLMILAFEKFEKLPLDTLKQL
    NCTC8325        IFKIAFPTDKSYQLSELAEAHGITLANAHRADEDAATTAKLMILAFEKFEKLPLDTLKQL
    Newman          IFKIAFPTDKSYQLSELAEAHGITLANAHRADEDAATTAKLMILAFEKFEKLPLDTLKQL
    USA300_FPR3757  IFKIAFPTDKSYQLSELAEAHGITLANAHRADEDAATTAKLMILAFEKFEKLPLDTLKQL
                    ************************************************************

    COL             YYLSKQLKYDLYDIFFEMVRQYDAKPLDKSYEKFEQIIYRKQVDFKKPTTNYNGSLKSLY
    N315            YYLSKQLKYDLYDIFFEMVRQYDAKPLDKSYEKFEQIIYRKQVDFKKPTTNYNGSLKSLY
    NCTC8325        YYLSKQLKYDLYDIFFEMVRQYDAKPLDKSYEKFEQIIYRKQVDFKKPTTNYNGSLKSLY
    Newman          YYLSKQLKYDLYDIFFEMVRQYDAKPLDKSYEKFEQIIYRKQVDFKKPTTNYNGSLKSLY
    USA300_FPR3757  YYLSKQLKYDLYDIFFEMVRQYDAKPLDKSYEKFEQIIYRKQVDFKKPTTNYNGSLKSLY
                    ************************************************************

    COL             SKAVDQLGLTYRPQQLYLAETILDQLMHSEKAMIEASLGSGKSLAYLLAALMYNIETGKH
    N315            SKAVDQLGLTYRPQQLYLAETILDQLMHSEKAMIEASLGSGKSLAYLLAALMYNIETGKH
    NCTC8325        SKAVDQLGLTYRPQQLYLAETILDQLMHSEKAMIEASLGSGKSLAYLLAALMYNIETGKH
    Newman          SKAVDQLGLTYRPQQLYLAETILDQLMHSEKAMIEASLGSGKSLAYLLAALMYNIETGKH
    USA300_FPR3757  SKAVDQLGLTYRPQQLYLAETILDQLMHSEKAMIEASLGSGKSLAYLLAALMYNIETGKH
                    ************************************************************

    COL             VMISTNTKLLQSQLLEKDIPAMNEALNFKINALLIKSKSDYISLGLISQILKDDTSNYEV
    N315            VMISTNTKLLQSQLLEKDIPAMNEALNFKINALLIKSKSDYISLGLISQILKDDTSNYEV
    NCTC8325        VMISTNTKLLQSQLLEKDIPAMNEALNFKINALLIKSKSDYISLGLISQILKDDTSNYEV
    Newman          VMISTNTKLLQSQLLEKDIPAMNEALNFKINALLIKSKSDYISLGLISQILKDDTSNYEV
    USA300_FPR3757  VMISTNTKLLQSQLLEKDIPAMNEALNFKINALLIKSKSDYISLGLISQILKDDTSNYEV
                    ************************************************************

    COL             NILKMQLLIWITETPSGDIQELNLKGGQKMYFDQKIETYVPARHDVHYYNFIKRNAQNIQ
    N315            NILKMQLLIWITETPSGDIQELNLKGGQKMYFDQKIETYVPARHDVHYYNFIKRNAQNIQ
    NCTC8325        NILKMQLLIWITETPSGDIQELNLKGGQKMYFDQKIETYVPARHDVHYYNFIKRNAQNIQ
    Newman          NILKMQLLIWITETPSGDIQELNLKGGQKMYFDQKIETYVPARHDVHYYNFIKRNAQNIQ
    USA300_FPR3757  NILKMQLLIWITETPSGDIQELNLKGGQKMYFDQKIETYVPARHDVHYYNFIKRNAQNIQ
                    ************************************************************

    COL             IGITNHAHLIHSDVENSIYQLFDDCIVDEAHRLPDYALNQVTNELSYADIKYQLGLIGKN
    N315            IGITNHAHLIHSDVENSIYQLFDDCIVDEAHRLPDYALNQVTNELSYADIKYQLGLIGKN
    NCTC8325        IGITNHAHLIHSDVENSIYQLFDDCIVDEAHRLPDYALNQVTNELSYADIKYQLGLIGKN
    Newman          IGITNHAHLIHSDVENSIYQLFDDCIVDEAHRLPDYALNQVTNELSYADIKYQLGLIGKN
    USA300_FPR3757  IGITNHAHLIHSDVENSIYQLFDDCIVDEAHRLPDYALNQVTNELSYADIKYQLGLIGKN
                    ************************************************************

    COL             ENEKLLKAIDQLEKQRILEKLDIAPIDIFGLKASMNEIHELNEQLFSTIFTIINDSDVYD
    N315            ENEKLLKAIDQLEKQRILEKLDIAPIDIFGLKASMNEIHELNEQLFSTIFTIINDSDVYD
    NCTC8325        ENEKLLKAIDQLEKQRILEKLDIAPIDIFGLKASMNEIHELNEQLFSTIFTIINDSDVYD
    Newman          ENEKLLKAIDQLEKQRILEKLDIAPIDIFGLKASMNEIHELNEQLFSTIFTIINDSDVYD
    USA300_FPR3757  ENEKLLKAIDQLEKQRILEKLDIAPIDIFGLKASMNEIHELNEQLFSTIFTIINDSDVYD
                    ************************************************************

    COL             DDIHRFHNVFTFETKDILKDLHAIIDKLNKTLEIFNGISHKTVKSLRKQLLYLKDKFKNI
    N315            DDIHRFHNVFTFETKDILKDLHAIIDKLNKTLEIFNGISHKTVKSLRKQLLYLKDKFKNI
    NCTC8325        DDIHRFHNVFTFETKDILKDLHAIIDKLNKTLEIFNGISHKTVKSLRKQLLYLKDKFKNI
    Newman          DDIHRFHNVFTFETKDILKDLHAIIDKLNKTLEIFNGISHKTVKSLRKQLLYLKDKFKNI
    USA300_FPR3757  DDIHRFHNVFTFETKDILKDLHAIIDKLNKTLEIFNGISHKTVKSLRKQLLYLKDKFKNI
                    ************************************************************

    COL             EQSLKAGHTSFISIKNLSQKSTIRLYVKDYAVKDVLTKQVLEKFKSLIFISGTLKFNHSF
    N315            EQSLKAGHTSFISIKNLSQKSTIRLYVKDYAVKDVLTKQVLEKFKSLIFISGTLKFNHSF
    NCTC8325        EQSLKAGHTSFISIKNLSQKSTIRLYVKDYAVKDVLTKQVLEKFKSLIFISGTLKFNHSF
    Newman          EQSLKAGHTSFISIKNLSQKSTIRLYVKDYAVKDVLTKQVLEKFKSLIFISGTLKFNHSF
    USA300_FPR3757  EQSLKAGHTSFISIKNLSQKSTIRLYVKDYAVKDVLTKQVLEKFKSLIFISGTLKFNHSF
                    ************************************************************

    COL             EAFKQLFNKDVHFNTFEVNTSLQSAKNTSVFIPSDVASYQYKNIDEYVASIVSYIIEYTT
    N315            EAFKQLFNKDVHFNTFEVNTSLQSAKNTSVFIPSDVASYQYKNIDEYVASIVSYIIEYTT
    NCTC8325        EAFKQLFNKDVHFNTFEVNTSLQSAKNTSVFIPSDVASYQYKNIDEYVASIVSYIIEYTT
    Newman          EAFKQLFNKDVHFNTFEVNTSLQSAKNTSVFIPSDVASYQYKNIDEYVASIVSYIIEYTT
    USA300_FPR3757  EAFKQLFNKDVHFNTFEVNTSLQSAKNTSVFIPSDVASYQYKNIDEYVASIVSYIIEYTT
                    ************************************************************

    COL             ITSSKCLVLFTSYKMMHMVQDMLNELPEFEDYVVLTQQQNQNYKIVQQFNNFDKAILLGT
    N315            ITSSKCLVLFTSYKMMHMVQDMLNELPEFEDYVVLTQQQNQNYKIVQQFNNFDKAILLGT
    NCTC8325        ITSSKCLVLFTSYKMMHMVQDMLNELPEFEDYVVLTQQQNQNYKIVQQFNNFDKAILLGT
    Newman          ITSSKCLVLFTSYKMMHMVQDMLNELPEFEDYVVLTQQQNQNYKIVQQFNNFDKAILLGT
    USA300_FPR3757  ITSSKCLVLFTSYKMMHMVQDMLNELPEFEDYVVLTQQQNQNYKIVQQFNNFDKAILLGT
                    ************************************************************

    COL             STFFEGFDFQANGIKCVMIAKLPFMNKHNAKYWLMDSEFTSTFKEYVLPDAVTRFRQGLG
    N315            STFFEGFDFQANGIKCVMIAKLPFMNKHNAKYWLMDSEFTSTFKEYVLPDAVTRFRQGLG
    NCTC8325        STFFEGFDFQANGIKCVMIAKLPFMNKHNAKYWLMDSEFTSTFKEYVLPDAVTRFRQGLG
    Newman          STFFEGFDFQANGIKCVMIAKLPFMNKHNAKYWLMDSEFTSTFKEYVLPDAVTRFRQGLG
    USA300_FPR3757  STFFEGFDFQANGIKCVMIAKLPFMNKHNAKYWLMDSEFTSTFKEYVLPDAVTRFRQGLG
                    ************************************************************

    COL             RLIRNENDRGIIVSFDDRLINSNYKNFFEQTLENYRQKKGDIQQFGKLLRQIQKKKK
    N315            RLIRNENDRGIIVSFDDRLINSNYKNFFEQTLENYRQKKGDIQQFGKLLRQIQKKKK
    NCTC8325        RLIRNENDRGIIVSFDDRLINSNYKNFFEQTLENYRQKKGDIQQFGKLLRQIQKKKK
    Newman          RLIRNENDRGIIVSFDDRLINSNYKNFFEQTLENYRQKKGDIQQFGKLLRQIQKKKK
    USA300_FPR3757  RLIRNENDRGIIVSFDDRLINSNYKNFFEQTLENYRQKKGDIQQFGKLLRQIQKKKK
                    *********************************************************