From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003919000
  • symbol?:
  • description?: MazG family protein

      descriptions from strain specific annotations:

    • MazG family protein
    • MazG nucleotide pyrophosphohydrolase
    • MazG nucleotide pyrophosphohydrolase domain-containing protein
    • mazG nucleotide pyrophosphohydrolase domain protein
    • MazG nucleotide pyrophosphohydrolase domain superfamily
    • nucleoside triphosphate pyrophosphohydrolase
    • Pyrophosphohydrolase, MazG family
  • strand?: -
  • coordinates?: 4240409..4240726
  • synteny block?: BlockID0029650
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1415 (mazG)
    08BA02176:
    C248_1499
    11819-97:
    MS7_1415
    71193:
    ST398NM01_1459
    ECT-R 2:
    ECTR2_1313
    ED133:
    SAOV_1467
    ED98:
    SAAV_1446
    HO 5096 0412:
    SAEMRSA15_13200
    JH1:
    SaurJH1_1547
    JH9:
    SaurJH9_1518
    JKD6008:
    SAA6008_01428 (mazG)
    JKD6159:
    SAA6159_01324 (mazG)
    LGA251:
    SARLGA251_13730
    M013:
    M013TW_1407
    MRSA252:
    SAR1470
    MSHR1132:
    SAMSHR1132_12990
    MSSA476:
    SAS1402
    Mu3:
    SAHV_1447
    Mu50:
    SAV1459
    MW2:
    MW1349
    RF122:
    SAB1323c
    ST398:
    SAPIG1459
    T0131:
    SAT0131_01548
    TCH60:
    HMPREF0772_11745 (ypjD)
    TW20:
    SATW20_14580
    USA300_TCH1516:
    USA300HOU_1397
    VC40:
    SAVC_06550

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---------------MKSMVEMQREVDEYIGQFKTGYFSPLANLARLTEEVGELAREINH
    N315            ---------------MKSMVEMQREVDEYIGQFKTGYFSPLANLARLTEEVGELAREINH
    NCTC8325        ---------------MKSMVEMQREVDEYIGQFKTGYFSPLANLARLTEEVGELAREINH
    Newman          MIYTILEMQYKENVEMKSMVEMQREVDEYIGQFKTGYFSPLANLARLTEEVGELAREINH
    USA300_FPR3757  ---------------MKSMVEMQREVDEYIGQFKTGYFSPLANLARLTEEVGELAREINH
                                   *********************************************

    COL             TYGEKKKKDSEEANTIKAELGDNLFVLLCLANSMGIDMTESFNETMEKFNTRDKNRFERK
    N315            TYGEKKKKDSEEANTIKAELGDNLFVLLCLANSMGIDMTESFNETMEKFNTRDKNRFERK
    NCTC8325        TYGEKKKKDSEEANTIKAELGDNLFVLLCLANSMGIDMTESFNETMEKFNTRDKNRFERK
    Newman          TYGEKKKKDSEEANTIKAELGDNLFVLLCLANSMGIDMTESFNETMEKFNTRDKNRFERK
    USA300_FPR3757  TYGEKKKKDSEEANTIKAELGDNLFVLLCLANSMGIDMTESFNETMEKFNTRDKNRFERK
                    ************************************************************