From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003936000
  • symbol?: engA
  • description?: GTP-binding protein EngA

      descriptions from strain specific annotations:

    • GTP-binding protein EngA
    • ribosome biogenesis GTPase Der
    • GTP-binding protein Der
    • pseudogene
    • putative GTPase
    • ribosome-associated GTPase EngA
    • small GTP-binding domain protein
  • strand?: -
  • coordinates?: 4253923..4255235
  • synteny block?: BlockID0029820
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1515 (engA)
    N315:
    SA1307 (engA)
    NCTC8325:
    Newman:
    NWMN_1384 (engA)
    USA300_FPR3757:
    04-02981:
    SA2981_1431 (engA)
    08BA02176:
    C248_1514
    11819-97:
    MS7_1429 (engA)
    71193:
    ST398NM01_1473
    ECT-R 2:
    ECTR2_1327
    ED133:
    SAOV_1481
    ED98:
    SAAV_1462 (engA)
    HO 5096 0412:
    SAEMRSA15_13350
    JH1:
    SaurJH1_1562 (engA)
    JH9:
    SaurJH9_1532 (engA)
    JKD6008:
    SAA6008_01443 (engA)
    JKD6159:
    SAA6159_01339 (engA)
    LGA251:
    SARLGA251_13870
    M013:
    M013TW_1422
    MRSA252:
    SAR1484 (engA)
    MSHR1132:
    SAMSHR1132_13140
    MSSA476:
    SAS1416 (engA)
    Mu3:
    SAHV_1463 (engA)
    Mu50:
    SAV1475 (engA)
    MW2:
    MW1364 (engA)
    RF122:
    SAB1337c
    ST398:
    SAPIG1473 (engA)
    T0131:
    SAT0131_01563
    TCH60:
    HMPREF0772_11731 (engA)
    TW20:
    SATW20_14720
    USA300_TCH1516:
    USA300HOU_1412 (engA)
    VC40:
    SAVC_06625

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKPIVAIVGRPNVGKSTIFNRIVGERVSIVEDTPGVTRDRIYSSGEWLTHDFNIIDTGG
    N315            MTKPIVAIVGRPNVGKSTIFNRIVGERVSIVEDTPGVTRDRIYSSGEWLTHDFNIIDTGG
    NCTC8325        MTKPIVAIVGRPNVGKSTIFNRIVGERVSIVEDTPGVTRDRIYSSGEWLTHDFNIIDTGG
    Newman          MTKPIVAIVGRPNVGKSTIFNRIVGERVSIVEDTPGVTRDRIYSSGEWLTHDFNIIDTGG
    USA300_FPR3757  MTKPIVAIVGRPNVGKSTIFNRIVGERVSIVEDTPGVTRDRIYSSGEWLTHDFNIIDTGG
                    ************************************************************

    COL             IEIGDAPFQTQIRAQAEIAIDEADVIIFMVNVREGLTQSDEMVAQILYKSKKPVVLAVNK
    N315            IEIGDAPFQTQIRAQAEIAIDEADVIIFMVNVREGLTQSDEMVAQILYKSKKPVVLAVNK
    NCTC8325        IEIGDAPFQTQIRAQAEIAIDEADVIIFMVNVREGLTQSDEMVAQILYKSKKPVVLAVNK
    Newman          IEIGDAPFQTQIRAQAEIAIDEADVIIFMVNVREGLTQSDEMVAQILYKSKKPVVLAVNK
    USA300_FPR3757  IEIGDAPFQTQIRAQAEIAIDEAYVIIFMVNVREGLTQSDEMVAQILYKSKKPVVLAVNK
                    *********************** ************************************

    COL             VDNMEMRTDVYDFYSLGFGEPYPISGSHGLGLGDLLDAVVSHFGEEEEDPYDEDTIRLSI
    N315            VDNMEMRTDVYDFYSLGFGEPYPISGSHGLGLGDLLDAVVSHFGEEEEDPYDEDTIRLSI
    NCTC8325        VDNMEMRTDVYDFYSLGFGEPYPISGSHGLGLGDLLDAVVSHFGEEEEDPYDEDTIRLSI
    Newman          VDNMEMRTDVYDFYSLGFGEPYPISGSHGLGLGDLLDAVVSHFGEEEEDPYDEDTIRLSI
    USA300_FPR3757  VDNMEMRTDVYDFYSLGFGEPYPISGSHGLGLGDLLDAVVSHFGEEEEDPYDEDTIRLSI
                    ************************************************************

    COL             IGRPNVGKSSLVNAILGEDRVIVSNVAGTTRDAIDTEYSYDGQDYVLIDTAGMRKKGKVY
    N315            IGRPNVGKSSLVNAILGEDRVIVSNVAGTTRDAIDTEYSYDGQDYVLIDTAGMRKKGKVY
    NCTC8325        IGRPNVGKSSLVNAILGEDRVIVSNVAGTTRDAIDTEYSYDGQDYVLIDTAGMRKKGKVY
    Newman          IGRPNVGKSSLVNAILGEDRVIVSNVAGTTRDAIDTEYSYDGQDYVLIDTAGMRKKGKVY
    USA300_FPR3757  IGRPNVGKSSLVNAILGEDRVIVSNVAGTTRDAIDTEYSYDGQDYVLIDTAGMRKKGKVY
                    ************************************************************

    COL             ESTEKYSVLRALKAIERSNVVLVVIDAEQGIIEQDKRVAGYAHEQGKAVVIVVNKWDTVE
    N315            ESTEKYSVLRALKAIERSNVVLVVIDAEQGIIEQDKRVAGYAHEQGKAVVIVVNKWDTVE
    NCTC8325        ESTEKYSVLRALKAIERSNVVLVVIDAEQGIIEQDKRVAGYAHEQGKAVVIVVNKWDTVE
    Newman          ESTEKYSVLRALKAIERSNVVLVVIDAEQGIIEQDKRVAGYAHEQGKAVVIVVNKWDTVE
    USA300_FPR3757  ESTEKYSVLRALKAIERSNVVLVVIDAEQGIIEQDKRVAGYAHEQGKAVVIVVNKWDTVE
                    ************************************************************

    COL             KDSKTMKKFEDEVRKEFQFLDYAQIAFVSAKERTRLRTLFPYINEASENHKKRVQSSTLN
    N315            KDSKTMKKFEDEVRKEFQFLDYAQIAFVSAKERTRLRTLFPYINEASENHKKRVQSSTLN
    NCTC8325        KDSKTMKKFEDEVRKEFQFLDYAQIAFVSAKERTRLRTLFPYINEASENHKKRVQSSTLN
    Newman          KDSKTMKKFEDEVRKEFQFLDYAQIAFVSAKERTRLRTLFPYINEASENHKKRVQSSTLN
    USA300_FPR3757  KDSKTMKKFEDEVRKEFQFLDYAQIAFVSAKERTRLRTLFPYINEASENHKKRVQSSTLN
                    ************************************************************

    COL             EVVTDAISMNPTPTDKGRRLNVFYATQVAIEPPTFVVFVNDVELMHFSYKRYLENQIRAA
    N315            EVVTDAISMNPTPTDKGRRLNVFYATQVAIEPPTFVVFVNDVELMHFSYKRYLENQIRAA
    NCTC8325        EVVTDAISMNPTPTDKGRRLNVFYATQVAIEPPTFVVFVNDVELMHFSYKRYLENQIRAA
    Newman          EVVTDAISMNPTPTDKGRRLNVFYATQVAIEPPTFVVFVNDVELMHFSYKRYLENQIRAA
    USA300_FPR3757  EVVTGAISMNPTPTDKGRRLNVFYATQVAIEPPTFVVFVNDVELMHFSYKRYLENQIRAA
                    ****.*******************************************************

    COL             FGFEGTPIHIIARKRN
    N315            FGFEGTPIHIIARKRN
    NCTC8325        FGFEGTPIHIIARKRN
    Newman          FGFEGTPIHIIARKRN
    USA300_FPR3757  FGFEGTPIHIIARKRN
                    ****************