From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003948000
  • symbol?:
  • description?: hypothetical protein YpbB
  • strand?: -
  • coordinates?: 4264440..4265399
  • synteny block?: BlockID0029940
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1439 (ypbB)
    08BA02176:
    C248_1523
    11819-97:
    MS7_1436
    71193:
    ST398NM01_1482
    ECT-R 2:
    ECTR2_1334
    ED133:
    SAOV_1489
    ED98:
    SAAV_1470
    HO 5096 0412:
    SAEMRSA15_13420
    JH1:
    SaurJH1_1570
    JH9:
    SaurJH9_1539
    JKD6008:
    SAA6008_01451
    JKD6159:
    SAA6159_01346
    LGA251:
    SARLGA251_13950
    M013:
    M013TW_1430
    MRSA252:
    SAR1491
    MSHR1132:
    SAMSHR1132_13210
    MSSA476:
    SAS1423
    Mu3:
    SAHV_1471
    Mu50:
    SAV1483
    MW2:
    MW1371
    RF122:
    SAB1345c
    ST398:
    SAPIG1482
    T0131:
    SAT0131_01572
    TCH60:
    HMPREF0772_11723
    TW20:
    SATW20_14800
    USA300_TCH1516:
    USA300HOU_1421
    VC40:
    SAVC_06660

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQHIIKTALQQTFNYKTNKSIYNILVGKKSHQTFFDACSQQQLSLYHSLPLLKYPSFELF
    N315            MQHIIKTALQQTFNYKTNKSIYNILVGKKSHQTFFDACSQQQLSLYHSLPLLKYPSFELF
    NCTC8325        MQHIIKTALQQTFNYKTNKSIYNILVGKKSHQTFFDACSQQQLSLYHSLPLLKYPSFELF
    Newman          MQHIIKTALQQTFNYKTNKSIYNILVGKKSHQTFFDACSQQQLSLYHSLPLLKYPSFELF
    USA300_FPR3757  MQHIIKTALQQTFNYKTNKSIYNILVGKKSHQTFFDACSQQQLSLYHSLPLLKYPSFELF
                    ************************************************************

    COL             LEKINEFNAEMEIMLHPRYTFESMGQTFQAIQLLVQTMSNTKQHVFHFVPISQNNKIQET
    N315            LEKINEFNAEMEIMLHPRYTFESMGQTFQAIQLLVQTMSNTKQHVFHFVPISQNNKIQET
    NCTC8325        LEKINEFNAEMEIMLHPRYTFESMGQTFQAIQLLVQTMSNTKQHVFHFVPISQNNKIQET
    Newman          LEKINEFNAEMEIMLHPRYTFESMGQTFQAIQLLVQTMSNTKQHVFHFVPISQNNKIQET
    USA300_FPR3757  LEKINEFNAEMEIMLHPRYTFESMGQTFQAIQLLVQTMSNTKQHVFHFVPISQNNKIQET
                    ************************************************************

    COL             VKIVYNYIKENQLQIDFENELHNLFKAITLKGPCYLHYYLQGYDEPMYTRQQVSLIEKLS
    N315            VKIVYNYIKENQLQIDFENELHNLFKAITLKGPCYLHYYLQGYDEPMYTRQQVSLIEKLS
    NCTC8325        VKIVYNYIKENQLQIDFENELHNLFKAITLKGPCYLHYYLQGYDEPMYTRQQVSLIEKLS
    Newman          VKIVYNYIKENQLQIDFENELHNLFKAITLKGPCYLHYYLQGYDEPMYTRQQVSLIEKLS
    USA300_FPR3757  VKIVYNYIKENQLQIDFENELHNLFKAITLKGPCYLHYYLQGYDEPMYTRQQVSLIEKLS
                    ************************************************************

    COL             QQQLFEYEMNNLVTMMFELESGEYTILSKIIMKPTLLNQTYITYTKLLEQFTMEDIAAQQ
    N315            QQQLFEYEMNNLVTMMFELESGEYTILSKIIMKPTLLNQTYITYTKLLEQFTMEDIAAQQ
    NCTC8325        QQQLFEYEMNNLVTMMFELESGEYTILSKIIMKPTLLNQTYITYTKLLEQFTMEDIAAQQ
    Newman          QQQLFEYEMNNLVTMMFELESGEYTILSKIIMKPTLLNQTYITYTKLLEQFTMEDIAAQQ
    USA300_FPR3757  QQQLFEYEMNNLVTMMFELESGEYTILSKIIMKPTLLNQTYITYTKLLEQFTMEDIAAQQ
                    ************************************************************

    COL             QVKINTIEDHVLEILIKGYMSNYDDYVELEDQLQFLNFYQQHRGERLKFYKEQFDTLSYF
    N315            QVKINTIEDHVLEILIKGYMSNYDDYVELEDQLQFLNFYQQHRGERLKFYKEQFDTLSYF
    NCTC8325        QVKINTIEDHVLEILIKGYMSNYDDYVELEDQLQFLNFYQQHRGERLKFYKEQFDTLSYF
    Newman          QVKINTIEDHVLEILIKGYMSNYDDYVELEDQLQFLNFYQQHRGERLKFYKEQFDTLSYF
    USA300_FPR3757  QVKINTIEDHVLEILIKGYMSNYDDYVELEDQLQFLNFYQQHRGERLKFYKEQFDTLSYF
                    ************************************************************

    COL             QLKVLIVGFERGDLNVA
    N315            QLKVLIVGFERGDLNVA
    NCTC8325        QLKVLIVGFERGDLNVA
    Newman          QLKVLIVGFERGDLNVA
    USA300_FPR3757  QLKVLIVGFERGDLNVA
                    *****************