From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN003957000
  • symbol?:
  • description?: putative lipoprotein

      descriptions from strain specific annotations:

    • putative lipoprotein
    • lipoprotein
    • LMP group of surface-lacated membrane protein
  • strand?: -
  • coordinates?: 4269778..4271305
  • synteny block?: BlockID0030030
  • occurrence?: in 59% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1444
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ECTR2_1340
    ED133:
    ED98:
    HO 5096 0412:
    JH1:
    SaurJH1_1575
    JH9:
    SaurJH9_1544
    JKD6008:
    SAA6008_01458
    JKD6159:
    LGA251:
    M013:
    M013TW_1504
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS1430
    Mu3:
    SAHV_1475 (graD)
    Mu50:
    SAV1487
    MW2:
    MW1444
    RF122:
    ST398:
    T0131:
    SAT0131_01581 (lpl8nm)
    TCH60:
    TW20:
    SATW20_14860
    USA300_TCH1516:
    USA300HOU_1428
    VC40:
    SAVC_06690

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFKRTKLILIATLLLSGCSTTNNESNKETKSVPEEMEASKYVGQGFQPPAEKDVVEFAKK
    N315            MFKRIKLILIATIILSGCSTTNNESNNETKSVPEEMEASKYVGQGFQLPAEKDAIEFAKK
    NCTC8325        MFKRTKLILIATLLLSGCSTTNNESNKETKSVPEEMEASKYVGQGFQPPAEKDVVEFAKK
    Newman          MFKRTKLILIATLLLSGCSTTNNESNKETKSVPEEMEASKYVGQGFQPPAEKDVVEFAKK
    USA300_FPR3757  MFKRTKLILIATLLLSGCSTTNNESNKETKSVPEEMEASKYVGQGFQPPAEKDVVEFAKK
                    **** *******::************:******************** *****.:*****

    COL             HKDKIAKRGEQFFMDNFGLKVKATNVVGSGKGVEVFVHCDDHDIVFNASIPFDKSIIESD
    N315            HRKEFEKVGEQFFKDNFGLKVKATNVVGKDDGVEVYVHCEDHGIVFNASLPLYKDAIHQK
    NCTC8325        HKDKIAKRGEQFFMDNFGLKVKATNVVGSGKGVEVFVHCDDHDIVFNASIPFDKSIIESD
    Newman          HKDKIAKRGEQFFMDNFGLKVKATNVVGSGKGVEVFVHCDDHDIVFNASIPFDKSIIESD
    USA300_FPR3757  HKDKIAKRGEQFFMDNFGLKVKATNVVGSGKGVEVFVHCDDHDIVFNASIPFDKSIIESD
                    *:.:: * ***** **************...****:***:**.******:*: *. *...

    COL             SSLRSEDKGDDMSTLVGTVLSGFEYRTQKEKYDNLYKFFKDNEEKYQYTGFTKEAINKTQ
    N315            GSMRSNDNGDDMSMMVGTVLSGFEYRAQKEKYDNLYKFLKENEKKYQYTGFTKEAINKTQ
    NCTC8325        SSLRSEDKGDDMSTLVGTVLSGFEYRTQKEKYDNLYKFFKDNEEKYQYTGFTKEAINKTQ
    Newman          SSLRSEDKGDDMSTLVGTVLSGFEYRTQKEKYDNLYKFFKDNEEKYQYTGFTKEAINKTQ
    USA300_FPR3757  SSLRSEDKGDDMSTLVGTVLSGFEYRTQKEKYDNLYKFFKDNEEKYQYTGFTKEAINKTQ
                    .*:**:*:***** :***********:***********:*:**:****************

    COL             NVGYKNEYFYITYSSRSLKEYRKYYEPLIHKNDKEFKEGMEQARKEVNYAANTDTVTTLF
    N315            NVGYQNEYFYITYLSRNLKEYRKYYEPLIHKKDKEFKEGMQRARKELNYTANTDVVSTLF
    NCTC8325        NVGYKNEYFYITYSSRSLKEYRKYYEPLIHKNDKEFKEGMEQARKEVNYAANTDTVTTLF
    Newman          NVGYKNEYFYITYSSRSLKEYRKYYEPLIHKNDKEFKEGMEQARKEVNYAANTDTVTTLF
    USA300_FPR3757  NVGYKNEYFYITYSSRSLKEYRKYYEPLIHKNDKEFKEGMEQARKEVNYAANTDTVTTLF
                    ****:******** **.**************:********::****:**:****.*:***

    COL             STKENFTKDNTVDDVIELSDKLYNFKNKPEKSTITIQIGKPTINTKKAFYDDNDPIEYGV
    N315            STKKNFTKDNTVDDVIELSNKLKDKPNMPQKSQVTIQLGKPSINTKKPFYDDINPIE---
    NCTC8325        STKENFTKDNTVDDVIELSDKLYNFKNKPEKSTITIQIGKPTINTKKAFYDDNDPIEYGV
    Newman          STKENFTKDNTVDDVIELSDKLYNFKNKPEKSTITIQIGKPTINTKKAFYDDNDPIEYGV
    USA300_FPR3757  STKENFTKDNTVDDVIELSDKLYNFKNKPEKSTITIQIGKPTINTKKAFYDDNDPIEYGV
                    ***:***************:** :  * *:** :***:***:*****.**** :***   

    COL             YRKDE
    N315            ----G
    NCTC8325        YRKDE
    Newman          YRKDE
    USA300_FPR3757  YRKDE