From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004025000
  • symbol?: srrA
  • description?: DNA-binding response regulator

      descriptions from strain specific annotations:

    • DNA-binding response regulator
    • DNA-binding response regulator SrrA
    • respiratory response protein SrrA
    • respiratory response protein, SrrA
    • transcriptional regulatory protein SrrA
    • transcriptional regulatory protein resD
    • DNA-binding response regulator ResD
    • pseudogene
    • respiratory response protein
    • response regulator protein
    • response regulator receiver
    • Staphylococcal respiratory response protein SrrA
    • two component transcriptional regulator
    • winged helix family two component transcriptional regulator
  • strand?: -
  • coordinates?: 4316437..4317162
  • synteny block?: BlockID0030620
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1535 (srrA)
    N315:
    SA1323 (srrA)
    NCTC8325:
    Newman:
    NWMN_1400 (srrA)
    USA300_FPR3757:
    04-02981:
    SA2981_1449 (srrA)
    08BA02176:
    C248_1532 (srrA)
    11819-97:
    MS7_1509 (srrA)
    71193:
    ST398NM01_1558
    ECT-R 2:
    ECTR2_1343
    ED133:
    SAOV_1494
    ED98:
    SAAV_1482 (srrA)
    HO 5096 0412:
    SAEMRSA15_14140 (srrA)
    JH1:
    SaurJH1_1580
    JH9:
    SaurJH9_1549
    JKD6008:
    SAA6008_01462 (srrA)
    JKD6159:
    SAA6159_01421 (srrA)
    LGA251:
    SARLGA251_14000 (srrA)
    M013:
    M013TW_1506
    MRSA252:
    SAR1568 (srrA)
    MSHR1132:
    SAMSHR1132_13310
    MSSA476:
    SAS1432
    Mu3:
    SAHV_1480 (srrA)
    Mu50:
    SAV1492 (srrA)
    MW2:
    MW1446 (srrA)
    RF122:
    SAB1353c (srrA)
    ST398:
    SAPIG1558
    T0131:
    SAT0131_01585
    TCH60:
    HMPREF0772_11649 (srrA)
    TW20:
    SATW20_14900 (srrA)
    USA300_TCH1516:
    USA300HOU_1494 (srrA)
    VC40:
    SAVC_06710

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSNEILIVDDEDRIRRLLKMYLERESFEIHEASNGQEAYELAMENNYACILLDLMLPEMD
    N315            MSNEILIVDDEDRIRRLLKMYLERESFEIHEASNGQEAYELAMENNYACILLDLMLPEMD
    NCTC8325        MSNEILIVDDEDRIRRLLKMYLERESFEIHEASNGQEAYELAMENNYACILLDLMLPEMD
    Newman          MSNEILIVDDEDRIRRLLKMYLERESFEIHEASNGQEAYELAMENNYACILLDLMLPEMD
    USA300_FPR3757  MSNEILIVDDEDRIRRLLKMYLERESFEIHEASNGQEAYELAMENNYACILLDLMLPEMD
                    ************************************************************

    COL             GIQVATKLREHKQTPIIMLTAKGEETNRVEGFESGADDYIVKPFSPREVVLRVKALLRRT
    N315            GIQVATKLREHKQTPIIMLTAKGEETNRVEGFESGADDYIVKPFSPREVVLRVKALLRRT
    NCTC8325        GIQVATKLREHKQTPIIMLTAKGEETNRVEGFESGADDYIVKPFSPREVVLRVKALLRRT
    Newman          GIQVATKLREHKQTPIIMLTAKGEETNRVEGFESGADDYIVKPFSPREVVLRVKALLRRT
    USA300_FPR3757  GIQVATKLREHKQTPIIMLTAKGEETNRVEGFESGADDYIVKPFSPREVVLRVKALLRRT
                    ************************************************************

    COL             QSTTVEQSEPHARDVIEFKHLEIDNDAHRVLADNQEVNLTPKEYELLIYLAKTPNKVFDR
    N315            QSTTVEQSEPHARDVIEFKHLEIDNDAHRVLADNQEVNLTPKEYELLIYLAKTPNKVFDR
    NCTC8325        QSTTVEQSEPHARDVIEFKHLEIDNDAHRVLADNQEVNLTPKEYELLIYLAKTPNKVFDR
    Newman          QSTTVEQSEPHARDVIEFKHLEIDNDAHRVLADNQEVNLTPKEYELLIYLAKTPNKVFDR
    USA300_FPR3757  QSTTVEQSEPHARDVIEFKHLEIDNDAHRVLADNQEVNLTPKEYELLIYLAKTPNKVFDR
                    ************************************************************

    COL             EQLLKEVWHYEFYGDLRTVDTHVKRLREKLNRVSSEAAHMIQTVWGVGYKFEVKSNDEPA
    N315            EQLLKEVWHYEFYGDLRTVDTHVKRLREKLNRVSSEAAHMIQTVWGVGYKFEVKSNDEPA
    NCTC8325        EQLLKEVWHYEFYGDLRTVDTHVKRLREKLNRVSSEAAHMIQTVWGVGYKFEVKSNDEPA
    Newman          EQLLKEVWHYEFYGDLRTVDTHVKRLREKLNRVSSEAAHMIQTVWGVGYKFEVKSNDEPA
    USA300_FPR3757  EQLLKEVWHYEFYGDLRTVDTHVKRLREKLNRVSSEAAHMIQTVWGVGYKFEVKSNDEPA
                    ************************************************************

    COL             K
    N315            K
    NCTC8325        K
    Newman          K
    USA300_FPR3757  K
                    *