From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004027000
  • symbol?: scpB
  • description?: transcriptional regulator

      descriptions from strain specific annotations:

    • transcriptional regulator
    • segregation and condensation protein B
    • Putative transcriptional regulators (Ypuh-like)
    • pseudogene
  • strand?: -
  • coordinates?: 4318025..4318567
  • synteny block?: BlockID0030640
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1537 (scpB)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1451
    08BA02176:
    C248_1534
    11819-97:
    MS7_1511 (scpB)
    71193:
    ST398NM01_1560
    ECT-R 2:
    ECTR2_1345 (scpB)
    ED133:
    SAOV_1496
    ED98:
    SAAV_1484 (scpB)
    HO 5096 0412:
    SAEMRSA15_14160
    JH1:
    SaurJH1_1582
    JH9:
    SaurJH9_1551
    JKD6008:
    SAA6008_01464 (scpB)
    JKD6159:
    SAA6159_01423 (scpB)
    LGA251:
    SARLGA251_14020
    M013:
    M013TW_1508
    MRSA252:
    SAR1570
    MSHR1132:
    SAMSHR1132_13330
    MSSA476:
    SAS1434
    Mu3:
    SAHV_1482
    Mu50:
    SAV1494
    MW2:
    MW1448
    RF122:
    SAB1355c
    ST398:
    SAPIG1560 (scpB)
    T0131:
    SAT0131_01587 (cobW)
    TCH60:
    HMPREF0772_11647 (scpB)
    TW20:
    SATW20_14920
    USA300_TCH1516:
    VC40:
    SAVC_06720

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDNHGILESLLFTAGDEGLDEKQLLEILDMSKDQLVELIENYSSHGLMIQRFGMTYVLTT
    N315            MDNHGILESLLFTAGDEGLDEKQLLEILDMSKDQLVELIENYSSHGLMIQRFGTTYVLTT
    NCTC8325        MDNHGILESLLFTAGDEGLDEKQLLEILDMSKDQLVELIENYSSHGLMIQRFGMTYVLTT
    Newman          MDNHGILESLLFTAGDEGLDEKQLLEILDMSKDQLVELIENYSSHGLMIQRFGMTYVLTT
    USA300_FPR3757  MDNHGILESLLFTAGDEGLDEKQLLEILDMSKDQLVELIENYSSHGLMIQRFGMTYVLTT
                    ***************************************************** ******

    COL             KKEAATYIEQLIEQKSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAK
    N315            KKEAATYIEQLIEQKSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAK
    NCTC8325        KKEAATYIEQLIEQKSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAK
    Newman          KKEAATYIEQLIEQKSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAK
    USA300_FPR3757  KKEAATYIEQLIEQKSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAK
                    ************************************************************

    COL             GLVEAKVVNEQRSQQLITTDLFLNVFGISNIEDLPTTEEDDEEMDAFFSNLVNQKGENND
    N315            GLVEAKVVNEQRSQQLITTDLFLNVFGISNIEDLPTTEEDDEEMDAFFSNLVNQKGENND
    NCTC8325        GLVEAKVVNEQRSQQLITTDLFLNVFGISNIEDLPTTEEDDEEMDAFFSNLVNQKGENND
    Newman          GLVEAKVVNEQRSQQLITTDLFLNVFGISNIEDLPTTEEDDEEMDAFFSNLVNQKGENND
    USA300_FPR3757  GLVEAKVVNEQRSQQLITTDLFLNVFGISNIEDLPTTEEDDEEMDAFFSNLVNQKGENND
                    ************************************************************