From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004029000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 4319383..4319889
  • synteny block?: BlockID0030660
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1453
    08BA02176:
    C248_1536
    11819-97:
    MS7_1513
    71193:
    ST398NM01_1562
    ECT-R 2:
    ECTR2_1347
    ED133:
    SAOV_1498
    ED98:
    SAAV_1486
    HO 5096 0412:
    SAEMRSA15_14180
    JH1:
    SaurJH1_1584
    JH9:
    SaurJH9_1553
    JKD6008:
    SAA6008_01466
    JKD6159:
    SAA6159_01425
    LGA251:
    SARLGA251_14040
    M013:
    M013TW_1510
    MRSA252:
    SAR1572
    MSHR1132:
    SAMSHR1132_13350
    MSSA476:
    SAS1436
    Mu3:
    SAHV_1484
    Mu50:
    SAV1496
    MW2:
    MW1450
    RF122:
    SAB1357
    ST398:
    SAPIG1562
    T0131:
    SAT0131_01589
    TCH60:
    HMPREF0772_11645
    TW20:
    SATW20_14940
    USA300_TCH1516:
    USA300HOU_1497
    VC40:
    SAVC_06730

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQQALINFYYQFHTKQHYFLCHDILEDAWKAENNYSKQDAVVSLILFATACYHYRRNNLK
    N315            MQQALINFYYQFHTKQHYFLCHDILEDAWKAENNYSKQDAVVSLILFATACYHYRRNNLK
    NCTC8325        MQQALINFYYQFHTKQHYFLCHDILEDAWKAENNYSKQDAVVSLILFATACYHYRRNNLK
    Newman          MQQALINFYYQFHTKQHYFLCHDILEDAWKAENNYSKQDAVVSLILFATACYHYRRNNLK
    USA300_FPR3757  MQQALINFYYQFHTKQHYFLCHDILEDAWKAENNYSKQDAVVSLILFATACYHYRRNNLK
                    ************************************************************

    COL             GAYKSFNKSKEIIQNAKDRDALYLNLNDYQLLIEQQIAKLNAAKPFSSVILPITPVFERI
    N315            GAYKSFNKSKEIIQNAKDRDALYLNLNDYQLLIEQQIAKLNAAKPFSSVILPITPVFERI
    NCTC8325        GAYKSFNKSKEIIQNAKDRDALYLNLNDYQLLIEQQIAKLNAAKPFSSVILPITPVFERI
    Newman          GAYKSFNKSKEIIQNAKDRDALYLNLNDYQLLIEQQIAKLNAAKPFSSVILPITPVFERI
    USA300_FPR3757  GAYKSFNKSKEIIQNAKDRDALYLNLNDYQLLIEQQIAKLNAAKPFSSVILPITPVFERI
                    ************************************************************

    COL             IKANYPDYDYNQETATDPFIVDHHMRRDRSEVIAAKEEAIQLRKHRRN
    N315            IKANYPDYDYNQETATDPFIVDHHMRRDRSEVIAAKEEAIQLRKHRRN
    NCTC8325        IKANYPDYDYNQETATDPFIVDHHMRRDRSEVIAAKEEAIQLRKHRRN
    Newman          IKANYPDYDYNQETATDPFIVDHHMRRDRSEVIAAKEEAIQLRKHRRN
    USA300_FPR3757  IKANYPDYDYNQETATDPFIVDHHMRRDRSEVIAAKEEAIQLRKHRRN
                    ************************************************