From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004031000
  • symbol?: fur
  • description?: ferric uptake regulator-like protein

      descriptions from strain specific annotations:

    • ferric uptake regulator-like protein
    • ferric uptake regulator family protein
    • ferric-uptake regulator
    • transcriptional regulator, Fur family
    • Ferric uptake regulation protein FUR
    • iron uptake regulatory protein
    • ferric uptake regulation protein
    • FUR family transcriptional regulator
    • transcriptional regulator, Fur family protein
    • Ferric uptake regulator, Fur family
    • iron transcriptional regulator
  • strand?: -
  • coordinates?: 4320903..4321352
  • synteny block?: BlockID0030680
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1455
    08BA02176:
    C248_1538 (fur)
    11819-97:
    MS7_1515 (fur)
    71193:
    ST398NM01_1564
    ECT-R 2:
    ECTR2_1349
    ED133:
    SAOV_1500
    ED98:
    SAAV_1488
    HO 5096 0412:
    SAEMRSA15_14200 (fur)
    JH1:
    SaurJH1_1586
    JH9:
    SaurJH9_1555
    JKD6008:
    SAA6008_01468 (fur)
    JKD6159:
    SAA6159_01427 (fur)
    LGA251:
    SARLGA251_14060 (fur)
    M013:
    M013TW_1512
    MRSA252:
    SAR1574 (fur)
    MSHR1132:
    SAMSHR1132_13370
    MSSA476:
    SAS1438
    Mu3:
    SAHV_1486
    Mu50:
    SAV1498
    MW2:
    MW1452
    RF122:
    SAB1359c (fur)
    ST398:
    SAPIG1564
    T0131:
    SAT0131_01591
    TCH60:
    HMPREF0772_11643 (fur)
    TW20:
    SATW20_14960 (fur)
    USA300_TCH1516:
    USA300HOU_1499
    VC40:
    SAVC_06740

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEERLNRVKQQLQQSSYKLTPQREATVRVLIENEKDHLSAEDVYLKVKDKAPEIGLATVY
    N315            MEERLNRVKQQLQQSSYKLTPQREATVRVLIENEKDHLSAEDVYLKVKDKAPEIGLATVY
    NCTC8325        MEERLNRVKQQLQQSSYKLTPQREATVRVLIENEKDHLSAEDVYLKVKDKAPEIGLATVY
    Newman          MEERLNRVKQQLQQSSYKLTPQREATVRVLIENEKDHLSAEDVYLKVKDKAPEIGLATVY
    USA300_FPR3757  MEERLNRVKQQLQQSSYKLTPQREATVRVLIENEKDHLSAEDVYLKVKDKAPEIGLATVY
                    ************************************************************

    COL             RTLELLAELKVVDKINFGDGVARFDLRKEGAKHFHHHLVCMECGRVDEIDEDLLPEVENR
    N315            RTLELLAELKVVDKINFGDGVARFDLRKEGAKHFHHHLVCMECGRVDEIDEDLLPEVENR
    NCTC8325        RTLELLAELKVVDKINFGDGVARFDLRKEGAKHFHHHLVCMECGRVDEIDEDLLPEVENR
    Newman          RTLELLAELKVVDKINFGDGVARFDLRKEGAKHFHHHLVCMECGRVDEIDEDLLPEVENR
    USA300_FPR3757  RTLELLAELKVVDKINFGDGVARFDLRKEGAKHFHHHLVCMECGRVDEIDEDLLPEVENR
                    ************************************************************

    COL             VENEFNFKILDHRLTFHGVCETCQAKGKG
    N315            VENEFNFKILDHRLTFHGVCETCQAKGKG
    NCTC8325        VENEFNFKILDHRLTFHGVCETCQAKGKG
    Newman          VENEFNFKILDHRLTFHGVCETCQAKGKG
    USA300_FPR3757  VENEFNFKILDHRLTFHGVCETCQAKGKG
                    *****************************