From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004033000
  • symbol?:
  • description?: aldo/keto reductase

      descriptions from strain specific annotations:

    • aldo/keto reductase
    • aldo/keto reductase oxidoreductase
    • aldo/keto reductase family protein
    • aldo/keto reductase family oxidoreductase
    • oxidoreductase
    • aldo/keto oxidoreductase
    • conserved oxidoreductase
    • dehydrogenase
    • putative oxidoreductase
  • strand?: +
  • coordinates?: 4322081..4322989
  • synteny block?: BlockID0030700
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1457
    08BA02176:
    C248_1540
    11819-97:
    MS7_1517
    71193:
    ST398NM01_1566
    ECT-R 2:
    ECTR2_1351
    ED133:
    SAOV_1502
    ED98:
    SAAV_1490
    HO 5096 0412:
    SAEMRSA15_14220
    JH1:
    SaurJH1_1588
    JH9:
    SaurJH9_1557
    JKD6008:
    SAA6008_01470
    JKD6159:
    SAA6159_01429
    LGA251:
    SARLGA251_14080
    M013:
    M013TW_1514
    MRSA252:
    SAR1576
    MSHR1132:
    SAMSHR1132_13390
    MSSA476:
    SAS1440
    Mu3:
    SAHV_1488
    Mu50:
    SAV1500
    MW2:
    MW1454
    RF122:
    SAB1361
    ST398:
    SAPIG1566
    T0131:
    SAT0131_01593 (opuCA)
    TCH60:
    HMPREF0772_11641
    TW20:
    SATW20_14980
    USA300_TCH1516:
    USA300HOU_1501
    VC40:
    SAVC_06750

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQKNILKSGISLSELGLGCMSLGTDLKKAEQIIDCAVENGITYFDTADMYDKGINESVVG
    N315            MQKNILKSGIALSELGLGCMSLGTDLKKAEQIIDCAVENGITYFDTADMYDKGINESVVG
    NCTC8325        MQKNILKSGISLSELGLGCMSLGTDLKKAEQIIDCAVENGITYFDTADMYDKGINESVVG
    Newman          MQKNILKSGISLSELGLGCMSLGTDLKKAEQIIDCAVENGITYFDTADMYDKGINESVVG
    USA300_FPR3757  MQKNILKSGISLSELGLGCMSLGTDLKKAEQIIDCAVENGITYFDTADMYDKGINESVVG
                    **********:*************************************************

    COL             KALLKYQQRDDIFIGTKVGNRLTKDGSTTWDPSKSYIKEAVKGSLKRLGIDHIDLYQLHG
    N315            KALLKYQQRDDIFIGTKVGNRLTKDGSTTWDPSKSYIKEAVKGSLKRLGIDHIDLYQLHG
    NCTC8325        KALLKYQQRDDIFIGTKVGNRLTKDGSTTWDPSKSYIKEAVKGSLKRLGIDHIDLYQLHG
    Newman          KALLKYQQRDDIFIGTKVGNRLTKDGSTTWDPSKSYIKEAVKGSLKRLGIDHIDLYQLHG
    USA300_FPR3757  KALLKYQQRDDIFIGTKVGNRLTKDGSTTWDPSKSYIKEAVKGSLKRLGIDHIDLYQLHG
                    ************************************************************

    COL             GTIDDPLDETISAFDELKQEGIIRAYGISSIRPNVIDYYLKHSQIETIMSQFNLIDNRPE
    N315            GTIDDPLDETISAFDELKQEGIIRAYGISSIRPNVIDYYLKHSQIETIMSQFNLIDNRPE
    NCTC8325        GTIDDPLDETISAFDELKQEGIIRAYGISSIRPNVIDYYLKHSQIETIMSQFNLIDNRPE
    Newman          GTIDDPLDETISAFDELKQEGIIRAYGISSIRPNVIDYYLKHSQIETIISQFNLIDNRPE
    USA300_FPR3757  GTIDDPLDETISAFDELKQEGIIRAYGISSIRPNVIDYYLKHSQIETIMSQFNLIDNRPE
                    ************************************************:***********

    COL             SLLDAIHNNDVKVLARGPVSKGLLTSNSVNVLDNKFKDGIFDYSHDELGETIASIKEIES
    N315            SLLDAIHNNDVKVLARGPVSKGLLTSNSVNVLDNKFKDGIFDYSHDELGETIASIKEIES
    NCTC8325        SLLDAIHNNDVKVLARGPVSKGLLTSNSVNVLDNKFKDGIFDYSHDELGETIASIKEIES
    Newman          SLLDAIHNNDVKVLARGPVSKGLLTSNSVNVLDNKFKDGIFDYSHDELGETIASIKEIES
    USA300_FPR3757  SLLDAIHNNDVKVLARGPVSKGLLTSNSVNVLDNKFKDGIFDYSHDELGETIASIKEIES
                    ************************************************************

    COL             NLSALTFSYLTSHDVLGSIIVGASSVDQLKENIENYHTKVSLDQIKTARARVKDLEYTNH
    N315            NLSALTFSYLTSHDVLGSIIVGASSVDQLKENIENYHTKVGLDQIKTARARVKDLEYTNH
    NCTC8325        NLSALTFSYLTSHDVLGSIIVGASSVDQLKENIENYHTKVSLDQIKTARARVKDLEYTNH
    Newman          NLSALTFSYLTSHDVLGSIIVGASSVDQLKENIENYHTKVSLDQIKTARARVKDLEYTNH
    USA300_FPR3757  NLSALTFSYLTSHDVLGSIIVGASSVDQLKENIENYHTKVSLDQIKTARARVKDLEYTNH
                    ****************************************.*******************

    COL             LV
    N315            LV
    NCTC8325        LV
    Newman          LV
    USA300_FPR3757  LV
                    **