From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004041000
  • symbol?:
  • description?: AraC family transcriptional regulator

      descriptions from strain specific annotations:

    • AraC family transcriptional regulator
    • transcriptional regulator AraC family protein
    • AarP
    • AraC/XylS family transcriptional regulator
    • AraC family regulatory protein
    • AraC family transcription regulator
    • regulatory helix-turn-helix proteins, AraC family protein
    • transcription activator, effector binding
    • transcription activator, effector binding domain-containing protein
    • transcription activator effector binding
    • transcriptional regulator, AraC family
    • Transcription regulator AraC/XylS family
  • strand?: +
  • coordinates?: 4328331..4329224
  • synteny block?: BlockID0030780
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1463
    08BA02176:
    C248_1548
    11819-97:
    MS7_1524
    71193:
    ST398NM01_1572
    ECT-R 2:
    ECTR2_1357
    ED133:
    SAOV_1508
    ED98:
    SAAV_1497
    HO 5096 0412:
    SAEMRSA15_14280
    JH1:
    SaurJH1_1594
    JH9:
    SaurJH9_1563
    JKD6008:
    SAA6008_01476
    JKD6159:
    SAA6159_01435
    LGA251:
    SARLGA251_14140
    M013:
    M013TW_1521
    MRSA252:
    SAR1583
    MSHR1132:
    SAMSHR1132_13450
    MSSA476:
    SAS1446
    Mu3:
    SAHV_1494 (graE)
    Mu50:
    SAV1506
    MW2:
    MW1460
    RF122:
    SAB1367
    ST398:
    SAPIG1572
    T0131:
    SAT0131_01600
    TCH60:
    HMPREF0772_11635
    TW20:
    SATW20_15040
    USA300_TCH1516:
    USA300HOU_1508
    VC40:
    SAVC_06780

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIELIGVKVLDVIKQIQQAIVYIEDRLLEPFNLQELSDYVGLSPYHLDQSFKMIVGLSPE
    N315            ---------MDVIKQIQQAIVYIEDRLLEPFNLQELSDYVGLSPYHLDQSFKMIVGLSPE
    NCTC8325        MIELIGVKVLDVIKQIQQAIVYIEDRLLEPFNLQELSDYVGLSPYHLDQSFKMIVGLSPE
    Newman          MIELIGVKVLDVIKQIQQAIVYIEDRLLEPFNLQELSDYVGLSPYHLDQSFKMIVGLSPE
    USA300_FPR3757  MIELIGVKVLDVIKQIQQAIVYIEDRLLEPFNLQELSDYVGLSPYHLDQSFKMIVGLSPE
                             :**************************************************

    COL             AYARARKMTLAANDVINGATRLVDIAKKYHYANSNDFANDFSDFHGVSPIQASTKKDELQ
    N315            AYARARKMTLAANDVINGATRLVDIAKKYHYANSNDFANDFSDFHGVSPIQASTKKDELQ
    NCTC8325        AYARARKMTLAANDVINGATRLVDIAKKYHYANSNDFANDFSDFHGVSPIQASTKKDELQ
    Newman          AYARARKMTLAANDVINGATRLVDIAKKYHYANSNDFANDFSDFHGVSPIQASTKKDELQ
    USA300_FPR3757  AYARARKMTLAANDVINGATRLVDIAKKYHYANSNDFANDFSDFHGVSPIQASTKKDELQ
                    ************************************************************

    COL             IQERLYIKLSTTERAPYPYRLEETDDISLVGYARFIDTKYLSHPFNVPDFLEDLLIDGKI
    N315            IQERLYIKLSTTERAPYPYRLEETDDISLVGYARFIDTKYLSHPFNVPDFLEDLLIDGKI
    NCTC8325        IQERLYIKLSTTERAPYPYRLEETDDISLVGYARFIDTKYLSHPFNVPDFLEDLLIDGKI
    Newman          IQERLYIKLSTTERAPYPYRLEETDDISLVGYARFIDTKYLSHPFNVPDFLEDLLIDGKI
    USA300_FPR3757  IQERLYIKLSTTERAPYPYRLEETDDISLVGYARFIDTKYLSHPFNVPDFLEDLLIDGKI
                    ************************************************************

    COL             KELRRYNDVSPFELFVISCPLENGLEIFVGVPSERYPAHLESRFLPGKHCAKFNLQGEID
    N315            KELRRYNDVSPFELFVISCPLENGLEIFVGVPSERYPAHLESRFLPGKHCAKFNLQGEID
    NCTC8325        KELRRYNDVSPFELFVISCPLENGLEIFVGVPSERYPAHLESRFLPGKHCAKFNLQGEID
    Newman          KELRRYNDVSPFELFVISCPLENGLEIFVGVPSERYPAHLESRFLPGKHCAKFNLQGEID
    USA300_FPR3757  KELRRYNDVSPFELFVISCPLENGLEIFVGVPSERYPAHLESRFLPGKHCAKFNLQGEID
                    ************************************************************

    COL             YATNEAWYYIESSLQLTLPYERNDLYVEVYPLDISFNDPFTKIQLWIPVKQSPYDED
    N315            YATNEAWYYIESSLQLTLPYERNDLYVEVYPLDISFNDPFTKIQLWIPVKQSPYDED
    NCTC8325        YATNEAWYYIESSLQLTLPYERNDLYVEVYPLDISFNDPFTKIQLWIPVKQSPYDED
    Newman          YATNEAWYYIESSLQLTLPYERNDLYVEVYPLDISFNDPFTKIQLWIPVKQSPYDED
    USA300_FPR3757  YATNEAWYYIESSLQLTLPYERNDLYVEVYPLDISFNDPFTKIQLWIPVKQSPYDED
                    *********************************************************