From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004079000
  • symbol?: nusB
  • description?: transcription antitermination protein NusB

      descriptions from strain specific annotations:

    • transcription antitermination protein NusB
    • N utilization substance protein B
    • Transcription termination protein NusB
    • N utilization substance protein B -like protein
    • putative N utilization substance protein B
    • transcription antitermination factor NusB
  • strand?: -
  • coordinates?: 4361033..4361432
  • synteny block?: BlockID0031110
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1569 (nusB)
    N315:
    SA1355 (nusB)
    NCTC8325:
    Newman:
    NWMN_1429 (nusB)
    USA300_FPR3757:
    04-02981:
    SA2981_1483 (nusB)
    08BA02176:
    C248_1567
    11819-97:
    MS7_1542 (nusB)
    71193:
    ST398NM01_1590
    ECT-R 2:
    ECTR2_1376 (nusB)
    ED133:
    SAOV_1525 (nusB)
    ED98:
    SAAV_1517 (nusB)
    HO 5096 0412:
    SAEMRSA15_14450
    JH1:
    SaurJH1_1616 (nusB)
    JH9:
    SaurJH9_1583 (nusB)
    JKD6008:
    SAA6008_01494 (nusB)
    JKD6159:
    SAA6159_01460 (nusB)
    LGA251:
    SARLGA251_14310
    M013:
    M013TW_1540
    MRSA252:
    SAR1602 (nusB)
    MSHR1132:
    SAMSHR1132_13650
    MSSA476:
    SAS1463 (nusB)
    Mu3:
    SAHV_1512 (nusB)
    Mu50:
    SAV1524 (nusB)
    MW2:
    MW1477 (nusB)
    RF122:
    SAB1397c (nusB)
    ST398:
    SAPIG1590 (nusB)
    T0131:
    SAT0131_01618
    TCH60:
    HMPREF0772_11616 (nusB)
    TW20:
    SATW20_15210
    USA300_TCH1516:
    USA300HOU_1526 (nusB)
    VC40:
    SAVC_06870 (nusB)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSRKESRVQAFQTLFQLEMKDSDLTINEAISFIKDDNPDLDFEFIHWLVSGVKDHEPVLD
    N315            MSRKESRVQAFQTLFQLEMKDSDLTINEAISFIKDDNPDLDFEFIHWLVSGVKDHEPVLD
    NCTC8325        MSRKESRVQAFQTLFQLEMKDSDLTINEAISFIKDDNPDLDFEFIHWLVSGVKDHEPVLD
    Newman          MSRKESRVQAFQTLFQLEMKDSDLTINEAISFIKDDNPDLDFEFIHWLVSGVKDHEPVLD
    USA300_FPR3757  MSRKESRVQAFQTLFQLEMKDSDLTINEAISFIKDDNPDLDFEFIHWLVSGVKGHEPVLD
                    *****************************************************.******

    COL             ETISPYLKDWTIARLLKTDRIILRMATYEILHSDTPAKVVMNEAVELTKQFSDDDHYKFI
    N315            ETISPYLKDWTIARLLKTDRIILRMATYEILHSDTPAKVVMNEAVELTKQFSDDDHYKFI
    NCTC8325        ETISPYLKDWTIARLLKTDRIILRMATYEILHSDTPAKVVMNEAVELTKQFSDDDHYKFI
    Newman          ETISPYLKDWTIARLLKTDRIILRMATYEILHSDTPAKVVMNEAVELTKQFSDDDHYKFI
    USA300_FPR3757  ETISPYLKDWTIARLLKTDRIILRMATYEILHSDTPAKVVMNEAVELTKQFSDDDHYKFI
                    ************************************************************

    COL             NGVLSNIKK
    N315            NGVLSNIKK
    NCTC8325        NGVLSNIKK
    Newman          NGVLSNIKK
    USA300_FPR3757  NGVLSNIKK
                    *********