From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004080000
  • symbol?:
  • description?: Asp23/Gls24 family envelope stress response protein

      descriptions from strain specific annotations:

    • Asp23/Gls24 family envelope stress response protein
    • alkaline shock protein
    • conserved protein YqhY
    • general stress protein, Gls24 family
    • YqhY like protein
  • strand?: -
  • coordinates?: 4361494..4361856
  • synteny block?: BlockID0031120
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1484
    08BA02176:
    C248_1568
    11819-97:
    MS7_1543
    71193:
    ST398NM01_1591
    ECT-R 2:
    ECTR2_1377
    ED133:
    SAOV_1526
    ED98:
    SAAV_1518
    HO 5096 0412:
    SAEMRSA15_14460
    JH1:
    SaurJH1_1617
    JH9:
    SaurJH9_1584
    JKD6008:
    SAA6008_01495
    JKD6159:
    SAA6159_01461
    LGA251:
    SARLGA251_14320
    M013:
    M013TW_1541
    MRSA252:
    SAR1603
    MSHR1132:
    SAMSHR1132_13660
    MSSA476:
    SAS1464
    Mu3:
    SAHV_1513
    Mu50:
    SAV1525
    MW2:
    MW1478
    RF122:
    SAB1398c
    ST398:
    SAPIG1591
    T0131:
    SAT0131_01619 (treC)
    TCH60:
    HMPREF0772_11615
    TW20:
    SATW20_15220
    USA300_TCH1516:
    USA300HOU_1527
    VC40:
    SAVC_06875

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVKVTDYSNSKLGKVEIAPEVLSVIASIATSEVEGITGHFAELKETNLEKVSRKNLSRDL
    N315            MVKVTDYSNSKLGKVEIAPEVLSVIASIATSEVEGITGHFAELKETNLEKVSRKNLSRDL
    NCTC8325        MVKVTDYSNSKLGKVEIAPEVLSVIASIATSEVEGITGHFAELKETNLEKVSRKNLSRDL
    Newman          MVKVTDYSNSKLGKVEIAPEVLSVIASIATSEVEGITGHFAELKETNLEKVSRKNLSRDL
    USA300_FPR3757  MVKVTDYSNSKLGKVEIAPEVLSVIASIATSEVEGITGHFAELKETNLEKVSRKNLSRDL
                    ************************************************************

    COL             KIESKEDGIYIDVYCALKHGVNISKTANKIQTSIFNSISNMTAIEPKQINIHITQIVIEK
    N315            KIESKEDGIYIDVYCALKHGVNISKTANKIQTSIFNSISNMTAIEPKQINIHITQIVIEK
    NCTC8325        KIESKEDGIYIDVYCALKHGVNISKTANKIQTSIFNSISNMTAIEPKQINIHITQIVIEK
    Newman          KIESKEDGIYIDVYCALKHGVNISKTANKIQTSIFNSISNMTAIEPKQINIHITQIVIEK
    USA300_FPR3757  KIESKEDGIYIDVYCALKHGVNISKTANKIQTSIFNSISNMTAIEPKQINIHITQIVIEK
                    ************************************************************