From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: saupan004111000
  • symbol?:
  • description?: rhodanese-like domain-containing protein

      descriptions from strain specific annotations:

    • rhodanese-like domain-containing protein
    • rhodanese domain-containing protein
    • sulfurtransferase
    • Rhodanese-like domain protein
    • putative rhodanese domain sulfurtransferase
    • rhodanese family protein
    • membrane protein
    • Rhodanese-related sulfurtransferase
  • strand?: +
  • coordinates?: 4386680..4387066
  • synteny block?: BlockID0031410
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1492
    08BA02176:
    C248_1576
    11819-97:
    MS7_1551
    71193:
    ST398NM01_1599
    ECT-R 2:
    ECTR2_1385
    ED133:
    SAOV_1534
    ED98:
    SAAV_1526
    HO 5096 0412:
    SAEMRSA15_14540
    JH1:
    SaurJH1_1625
    JH9:
    SaurJH9_1592
    JKD6008:
    SAA6008_01503
    JKD6159:
    SAA6159_01469
    LGA251:
    SARLGA251_14400
    M013:
    M013TW_1549
    MRSA252:
    SAR1611
    MSHR1132:
    SAMSHR1132_13740
    MSSA476:
    SAS1472
    Mu3:
    SAHV_1521
    Mu50:
    SAV1534
    MW2:
    MW1486
    RF122:
    SAB1406
    ST398:
    SAPIG1599
    T0131:
    SAT0131_01627
    TCH60:
    HMPREF0772_11607
    TW20:
    SATW20_15300
    USA300_TCH1516:
    USA300HOU_1535
    VC40:
    SAVC_06915

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSASLYIAIILVIAIIAYMIVQQILNKRAVKELDQNEFHNGIRKAQVIDVREKVDYDYGH
    N315            MSASLYIAIILVIAIIAYMIVQQILNKRAVKELDQNEFHNGIRKAQVIDVREKVDYDYGH
    NCTC8325        MSASLYIAIILVIAIIAYMIVQQILNKRAVKELDQNEFHNGIRKAQVIDVREKVDYDYGH
    Newman          MSASLYIAIILVIAIIAYMIVQQILNKRAVKELDQNEFHNGIRKAQVIDVREKVDYDYGH
    USA300_FPR3757  MSASLYIAIILVIAIIAYMIVQQILNKRAVKELDQNEFHNGIRKAQVIDVREKVDYDYGH
                    ************************************************************

    COL             INGSRNIPMTMFRQRFQGLRKDQPVYLCDANGIASYRAARILKKNGYTDIYMLKGGYKKW
    N315            INGSRNIPMTMFRQRFQGLRKDQPVYLCDANGIASYRAARILKKNGYTDIYMLKGGYKKW
    NCTC8325        INGSRNIPMTMFRQRFQGLRKDQPVYLCDANGIASYRAARILKKNGYTDIYMLKGGYKKW
    Newman          INGSRNIPMTMFRQRFQGLRKDQPVYLCDANGIASYRAARILKKNGYTDIYMLKGGYKKW
    USA300_FPR3757  INGSRNIPMTMFRQRFQGLRKDQPVYLCDANGIASYRAARILKKNGYTDIYMLKGGYKKW
                    ************************************************************

    COL             TGKIKSKK
    N315            TGKIKSKK
    NCTC8325        TGKIKSKK
    Newman          TGKIKSKK
    USA300_FPR3757  TGKIKSKK
                    ********