From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004112000
  • symbol?: gcvPB
  • description?: glycine dehydrogenase subunit 2

      descriptions from strain specific annotations:

    • glycine dehydrogenase subunit 2
    • glycine dehydrogenase
    • aminotransferase class-V family protein
    • glycine cleavage system P-family protein
    • glycine dehydrogenase (decarboxylating)
    • glycine dehydrogenase (glycine cleavage system P2 protein )
    • Glycine dehydrogenase [decarboxylating] (glycine cleavage system P2 protein)
    • glycine dehydrogenase [decarboxylating] subunit 2
    • putative glycine cleavage system P-protein
  • strand?: -
  • coordinates?: 4387586..4389058
  • synteny block?: BlockID0031420
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1439 (gcvPB)
    USA300_FPR3757:
    04-02981:
    SA2981_1493
    08BA02176:
    C248_1577
    11819-97:
    MS7_1552
    71193:
    ST398NM01_1600
    ECT-R 2:
    ECTR2_1386
    ED133:
    SAOV_1535
    ED98:
    SAAV_1527
    HO 5096 0412:
    SAEMRSA15_14550
    JH1:
    SaurJH1_1626
    JH9:
    SaurJH9_1593
    JKD6008:
    SAA6008_01504 (gcvPB)
    JKD6159:
    SAA6159_01470 (gcvPB)
    LGA251:
    SARLGA251_14410
    M013:
    M013TW_1550
    MRSA252:
    SAR1612
    MSHR1132:
    SAMSHR1132_13750
    MSSA476:
    SAS1473
    Mu3:
    SAHV_1522
    Mu50:
    SAV1535
    MW2:
    MW1487
    RF122:
    SAB1407c
    ST398:
    SAPIG1600
    T0131:
    SAT0131_01628
    TCH60:
    HMPREF0772_11606 (gcvP2)
    TW20:
    SATW20_15310
    USA300_TCH1516:
    USA300HOU_1536 (gcvPB)
    VC40:
    SAVC_06920

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTSKSSPLIFERSREGRYAYSLPKSDIKTNSVESLLDDKFIRKNKAEFPEVAELDLVRHY
    N315            MTSKSSPLIFERSREGRYAYSLPKSDIKTNSVESLLDDKFIRKNKAEFPEVAELDLVRHY
    NCTC8325        MTSKSSPLIFERSREGRYAYSLPKSDIKTNSVESLLDDKFIRKNKAEFPEVAELDLVRHY
    Newman          MTSKSSPLIFERSREGRYAYSLPKSDIKTNSVESLLDDKFIRKNKAEFPEVAELDLVRHY
    USA300_FPR3757  MTSKSSPLIFERSREGRYAYSLPKSDIKTNSVESLLDDKFIRKNKAEFPEVAELDLVRHY
                    ************************************************************

    COL             TELSNKNFGVDNGFYPLGSCTMKYNPKINEKVARIPGFSESHPLQDEDQVQGSLEIIYSL
    N315            TELSNKNFGVDNGFYPLGSCTMKYNPKINEKVARIPGFSESHPLQDEDQVQGSLEIIYSL
    NCTC8325        TELSNKNFGVDNGFYPLGSCTMKYNPKINEKVARIPGFSESHPLQDEDQVQGSLEIIYSL
    Newman          TELSNKNFGVDNGFYPLGSCTMKYNPKINEKVARIPGFSESHPLQDEDQVQGSLEIIYSL
    USA300_FPR3757  TELSNKNFGVDNGFYPLGSCTMKYNPKINEKVARIPGFSESHPLQDEDQVQGSLEIIYSL
                    ************************************************************

    COL             QEELKEITGMDEVTLQPAAGAHGEWTALMIFKAYHENNGEGHRDEVIVPDSAHGTNPASA
    N315            QEELKEITGMDEVTLQPAAGAHGEWTALMIFKAYHENNGEGHRDEVIVPDSAHGTNPASA
    NCTC8325        QEELKEITGMDEVTLQPAAGAHGEWTALMIFKAYHENNGEGHRDEVIVPDSAHGTNPASA
    Newman          QEELKEITGMDEVTLQPAAGAHGEWTALMIFKAYHENNGEGHRDEVIVPDSAHGTNPASA
    USA300_FPR3757  QEELKEITGMDEVTLQPAAGAHGEWTALMIFKAYHENNGEGHRDEVIVPDSAHGTNPASA
                    ************************************************************

    COL             SFAGFKSVTVKSNERGEVNIDDLKRVVNENTAAIMLTNPNTLGIFEKNIMEIREIVHNAG
    N315            SFAGFKSVTVKSNERGEVDIDDLKRVVNENTAAIMLTNPNTLGIFEKNIMEIREIVHNAG
    NCTC8325        SFAGFKSVTVKSNERGEVDIDDLKRVVNENTAAIMLTNPNTLGIFEKNIMEIREIVHNAG
    Newman          SFAGFKSVTVKSNERGEVNIDDLKRVVNENTAAIMLTNPNTLGIFEKNIMEIREIVHNAG
    USA300_FPR3757  SFAGFKSVTVKSNERGEVDIDDLKRVVNENTAAIMLTNPNTLGIFEKNIMEIREIVHNAG
                    ******************:*****************************************

    COL             GLLYYDGANLNAIMDKVRPGDMGFDAVHLNLHKTFTGPHGGGGPGSGPVGVVKELASYLP
    N315            GLLYYDGANLNAIMDKVRPGDMGFDAVHLNLHKTFTGPHGGGGPGSGPVGVVKELASYLP
    NCTC8325        GLLYYDGANLNAIMDKVRPGDMGFDAVHLNLHKTFTGPHGGGGPGSGPVGVVKELASYLP
    Newman          GLLYYDGANLNAIMDKVRPGDMGFDAVHLNLHKTFTGPHGGGGPGSGPVGVVKELASYLP
    USA300_FPR3757  GLLYYDGANLNAIMDKVRPGDMGFDAVHLNLHKTFTGPHGGGGPGSGPVGVVKELASYLP
                    ************************************************************

    COL             KPMVIKDGDKFKYDNDIKNSIGRVKPFYGNFGIYLRAYTYIRTMGATGLKEVSEAAVLNA
    N315            KPMVIKDGDKFKYDNDIKNSIGRVKPFYGNFGIYLRAYTYIRTMGATGLKEVSEAAVLNA
    NCTC8325        KPMVIKDGDKFKYDNDIKNSIGRVKPFYGNFGIYLRAYTYIRTMGATGLKEVSEAAVLNA
    Newman          KPMVIKDGDKFKYDNDIKNSIGRVKPFYGNFGIYLRAYTYIRTMGATGLKEVSEAAVLNA
    USA300_FPR3757  KPMVIKDGDKFKYDNDIKNSIGRVKPFYGNFGIYLRAYTYIRTMGATGLKEVSEAAVLNA
                    ************************************************************

    COL             NYIKARLSKHFEIPYKQYCKHEFVLSGVRQKEFGVRTLDMAKRLLDFGVHPPTIYFPLNV
    N315            NYIKARLSEHFEIPYKQYCKHEFVLSGVRQKEFGVRTLDMAKRLLDFGVHPPTIYFPLNV
    NCTC8325        NYIKARLSKHFEIPYKQYCKHEFVLSGVRQKEFGVRTLDMAKRLLDFGVHPPTIYFPLNV
    Newman          NYIKARLSKHFEIPYKQYCKHEFVLSGVRQKEFGVRTLDMAKRLLDFGVHPPTIYFPLNV
    USA300_FPR3757  NYIKARLSKHFEIPYKQYCKHEFVLSGVRQKEFGVRTLDMAKRLLDFGVHPPTIYFPLNV
                    ********:***************************************************

    COL             EEGMMIEPTETESKETLDYFIDTLISIAEEAKNDPDKVLEAPHTTVIDRLDEATAARKPI
    N315            EEGMMIEPTETESKETLDYFIDTLISIAEEAKNDPDKVLEAPHTTVIDRLDEATAARKPI
    NCTC8325        EEGMMIEPTETESKETLDYFIDTLISIAEEAKNDPDKVLEAPHTTVIDRLDEATAARKPI
    Newman          EEGMMIEPTETESKETLDYFIDTLISIAEEAKNDPDKVLEAPHTTVIDRLDEATAARKPI
    USA300_FPR3757  EEGMMIEPTETESKETLDYFIDTLISIAEEAKNDPDKVLEAPHTTVIDRLDEATAARKPI
                    ************************************************************

    COL             LKFENLKQEK
    N315            LKFENLKQEK
    NCTC8325        LKFENLKQEK
    Newman          LKFENLKQEK
    USA300_FPR3757  LKFENLKQEK
                    **********