From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004119000
  • symbol?: comGE
  • description?: competence protein ComGE

      descriptions from strain specific annotations:

    • competence protein ComGE
    • Late competence protein ComGE
    • exported protein
  • strand?: -
  • coordinates?: 4392849..4393151
  • synteny block?: BlockID0031490
  • occurrence?: in 91% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1498 (comGE)
    08BA02176:
    C248_1583
    11819-97:
    MS7_1557
    71193:
    ST398NM01_1605
    ECT-R 2:
    ECTR2_1391
    ED133:
    SAOV_1540
    ED98:
    HO 5096 0412:
    SAEMRSA15_14600
    JH1:
    SaurJH1_1632
    JH9:
    SaurJH9_1598
    JKD6008:
    SAA6008_01510
    JKD6159:
    SAA6159_01475
    LGA251:
    SARLGA251_14460
    M013:
    M013TW_1555
    MRSA252:
    SAR1617
    MSHR1132:
    SAMSHR1132_13810
    MSSA476:
    SAS1478
    Mu3:
    SAHV_1527
    Mu50:
    SAV1540
    MW2:
    MW1492
    RF122:
    SAB1412c
    ST398:
    SAPIG1605
    T0131:
    SAT0131_01634 (holB)
    TCH60:
    HMPREF0772_11601
    TW20:
    SATW20_15360
    USA300_TCH1516:
    USA300HOU_1542
    VC40:
    SAVC_06945

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            -------MKSYKCKGSFLIDSMAGFLLIGLITLLLIPMMNQMQASINHKLQSIDASKVIL
    NCTC8325        MKKEEFVMKSYKCKGSFLIDSMAGFLLIGLITLLLIPMMNQMQASINHKLQTIDASKVIL
    Newman          -------MKSYKCKGSFLIDSMAGFLLIGLITLLLIPMMNQMQASINHKLQTIDASKVIL
                           ********************************************:********

    N315            TTVSKINKEELKKGVTIGKYDIKQSDQQICAISKNTTSYQKTCIQY
    NCTC8325        TTVSKINKEELKKGVTIGKYDIKQSDQQICAISKNTTSYQKTCIQY
    Newman          TTVSKINKEELKKGVTIGKYDIKQSDQQICAISKNTTSYQKTCIQY
                    **********************************************