From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004121000
  • symbol?: comGC
  • description?: exogenous DNA-binding protein comGC

      descriptions from strain specific annotations:

    • exogenous DNA-binding protein comGC
    • competence protein ComGC-like protein
    • Late competence protein ComGC, access of DNA to ComEA
    • comG operon protein 3
    • prepilin-type N-terminal cleavage/methylation domain-containing protein
    • comG operon protein 3 precursor
    • putative competence protein ComGC
  • strand?: -
  • coordinates?: 4393604..4393870
  • synteny block?: BlockID0031510
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1599 (comGC)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1500 (comGC)
    08BA02176:
    C248_1585
    11819-97:
    MS7_1559
    71193:
    ST398NM01_1607
    ECT-R 2:
    ECTR2_1393
    ED133:
    SAOV_1542
    ED98:
    SAAV_1534 (comGC)
    HO 5096 0412:
    SAEMRSA15_14620
    JH1:
    SaurJH1_1634
    JH9:
    SaurJH9_1600
    JKD6008:
    SAA6008_01512 (comGC)
    JKD6159:
    SAA6159_01477 (comGC)
    LGA251:
    SARLGA251_14480
    M013:
    M013TW_1557
    MRSA252:
    SAR1619
    MSHR1132:
    SAMSHR1132_13830
    MSSA476:
    SAS1480
    Mu3:
    SAHV_1529
    Mu50:
    SAV1542
    MW2:
    MW1494
    RF122:
    SAB1414c
    ST398:
    SAPIG1607
    T0131:
    SAT0131_01636
    TCH60:
    HMPREF0772_11599 (comGC)
    TW20:
    SATW20_15380
    USA300_TCH1516:
    USA300HOU_1544
    VC40:
    SAVC_06955

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAY
    N315            MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAY
    NCTC8325        MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAY
    Newman          MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAY
    USA300_FPR3757  MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAY
                    ************************************************************

    COL             ALKHNRNPSSIEDLIADGFIKEAQKTCKSGETITISNGEAVAN
    N315            ALKHNRNPSSIEDLIADGFIKEAQKTCKSGETITISNGEAVAN
    NCTC8325        ALKHNRNPSSIEDLIADGFIKEAQKTCKSGETITISNGEAVAN
    Newman          ALKHNRNPSSIEDLIADGFIKEAQKTCKSGETITISNGEAVAN
    USA300_FPR3757  ALKHNRNPSSIEDLIADGFIKEAQKTCKSGETITISNGEAVAN
                    *******************************************