From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004124000
  • symbol?:
  • description?: MBL fold metallo-hydrolase

      descriptions from strain specific annotations:

    • MBL fold metallo-hydrolase
    • metallo-beta-lactamase
    • metallo-beta-lactamase superfamily protein
    • Hydroxyacylglutathione hydrolase
    • beta-lactamase domain-containing protein
    • Beta-lactamase domain protein
    • metallo-beta-lactamase family protein
  • strand?: -
  • coordinates?: 4395998..4396621
  • synteny block?: BlockID0031540
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1503
    08BA02176:
    C248_1588
    11819-97:
    MS7_1562
    71193:
    ST398NM01_1610
    ECT-R 2:
    ECTR2_1396
    ED133:
    SAOV_1545
    ED98:
    SAAV_1537
    HO 5096 0412:
    SAEMRSA15_14650
    JH1:
    SaurJH1_1637
    JH9:
    SaurJH9_1603
    JKD6008:
    SAA6008_01515
    JKD6159:
    SAA6159_01480
    LGA251:
    SARLGA251_14510
    M013:
    M013TW_1560
    MRSA252:
    SAR1622
    MSHR1132:
    SAMSHR1132_13860
    MSSA476:
    SAS1483
    Mu3:
    SAHV_1532
    Mu50:
    SAV1545
    MW2:
    MW1497
    RF122:
    SAB1417c
    ST398:
    SAPIG1610
    T0131:
    SAT0131_01639
    TCH60:
    HMPREF0772_11596
    TW20:
    SATW20_15410
    USA300_TCH1516:
    USA300HOU_1547
    VC40:
    SAVC_06970

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRISSLTLGLVDTNTYFIENDKAVILIDPSGESEKIIKKLNQINKPLKAILLTHAHFDHI
    N315            MRISSLTLGLVDTNTYFIENDKAVILIDPSGESEKIIKKLNQINKPLKAILLTHAHFDHI
    NCTC8325        MRISSLTLGLVDTNTYFIENDKAVILIDPSGESEKIIKKLNQINKPLKAILLTHAHFDHI
    Newman          MRISSLTLGLVDTNTYFIENDKAVILIDPSGESEKIIKKLNQINKPLKAILLTHAHFDHI
    USA300_FPR3757  MRISSLTLGLVDTNTYFIENDKAVILIDPSGESEKIIKKLNQINKPLKAILLTHAHFDHI
                    ************************************************************

    COL             GAVDDIVDRFDVPVYMHEAEFDFLKDPVKNGADKFKQYGLPIITSKVTPEKLNEGSTEIE
    N315            GAVDDIVDRFDVPVYMHEAEFDFLKDPVKNGADKFKQYGLPIITSKVTPEKLNEGSTEIE
    NCTC8325        GAVDDIVDRFDVPVYMHEAEFDFLKDPVKNGADKFKQYGLPIITSKVTPEKLNEGSTEIE
    Newman          GAVDDIVDRFDVPVYMHEAEFDFLKDPVKNGADKFKQYGLPIITSKVTPEKLNEGSTEIE
    USA300_FPR3757  GAVDDIVDRFDVPVYMHEAEFDFLKDPVKNGADKFKQYGLPIITSKVTPEKLNEGSTEIE
                    ************************************************************

    COL             GFKFNVLHTPGHSPGSLTYVFDEFAVVGDTLFNNGIGRTDLYKGDYETLVDSIQDKIFEL
    N315            GFKFNVLHTPGHSPGSLTYVFDEFAVVGDTLFNNGIGRTDLYKGDYETLVDSIQDKIFEL
    NCTC8325        GFKFNVLHTPGHSPGSLTYVFDEFAVVGDTLFNNGIGRTDLYKGDYETLVDSIQDKIFEL
    Newman          GFKFNVLHTPGHSPGSLTYVFDEFAVVGDTLFNNGIGRTDLYKGDYETLVDSIQDKIFEL
    USA300_FPR3757  GFKFNVLHTPGHSPGSLTYVFDEFAVVGDTLFNNGIGRTDLYKGDYETLVDSIQDKIFEL
                    ************************************************************

    COL             EGDLPLFPGHGPYTTVDDEQLNPFLHG
    N315            EGDLPLFPGHGPYTTVDDEQLNPFLHG
    NCTC8325        EGDLPLFPGHGPYTTVDDEQLNPFLHG
    Newman          EGDLPLFPGHGPYTTVDDEQLNPFLHG
    USA300_FPR3757  EGDLPLFPGHGPYTTVDDEQLNPFLHG
                    ***************************